Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   C2H97_RS00205 Genome accession   NZ_CP026038
Coordinates   31365..31739 (-) Length   124 a.a.
NCBI ID   WP_032726157.1    Uniprot ID   A0AAP2PZF3
Organism   Bacillus subtilis PY79 strain PK1_3     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 26365..36739
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  C2H97_RS00165 (C2H97_00165) yqhG 26696..27490 (+) 795 WP_032726154.1 YqhG family protein -
  C2H97_RS00170 (C2H97_00175) sinI 27674..27847 (+) 174 WP_014477323.1 anti-repressor SinI Regulator
  C2H97_RS00175 (C2H97_00180) sinR 27881..28216 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  C2H97_RS00180 (C2H97_00185) tasA 28308..29093 (-) 786 WP_014477324.1 biofilm matrix protein TasA -
  C2H97_RS00185 (C2H97_00190) sipW 29158..29730 (-) 573 WP_003246088.1 signal peptidase I SipW -
  C2H97_RS00190 (C2H97_00195) tapA 29714..30475 (-) 762 WP_120028361.1 amyloid fiber anchoring/assembly protein TapA -
  C2H97_RS00195 (C2H97_00200) yqzG 30746..31072 (+) 327 WP_038829733.1 YqzG/YhdC family protein -
  C2H97_RS00200 (C2H97_00205) spoIIT 31114..31293 (-) 180 WP_003230176.1 YqzE family protein -
  C2H97_RS00205 (C2H97_00210) comGG 31365..31739 (-) 375 WP_032726157.1 ComG operon protein ComGG Machinery gene
  C2H97_RS00210 (C2H97_00215) comGF 31740..32123 (-) 384 WP_070547529.1 ComG operon protein ComGF Machinery gene
  C2H97_RS00215 (C2H97_00220) comGE 32149..32496 (-) 348 WP_070547530.1 ComG operon protein 5 Machinery gene
  C2H97_RS00220 (C2H97_00225) comGD 32480..32911 (-) 432 WP_120028362.1 comG operon protein ComGD Machinery gene
  C2H97_RS00225 (C2H97_00230) comGC 32901..33197 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  C2H97_RS00230 (C2H97_00235) comGB 33211..34248 (-) 1038 WP_070547532.1 comG operon protein ComGB Machinery gene
  C2H97_RS00235 (C2H97_00240) comGA 34235..35305 (-) 1071 WP_070547533.1 competence protein ComGA Machinery gene
  C2H97_RS21445 (C2H97_00245) - 35516..35650 (-) 135 WP_257786427.1 hypothetical protein -
  C2H97_RS00240 (C2H97_00250) corA 35716..36669 (-) 954 WP_015483432.1 magnesium transporter CorA -

Sequence

Protein


Download         Length: 124 a.a.        Molecular weight: 14510.75 Da        Isoelectric Point: 9.7778

>NTDB_id=265740 C2H97_RS00205 WP_032726157.1 31365..31739(-) (comGG) [Bacillus subtilis PY79 strain PK1_3]
MYRTRGFIYPAVLFVSALVLLIVNFAAAQYISRCMFEKETKELYIGENLLQNGTLLSIRHVLEKRKGQEGTQQFPYGRVS
YYIHDTSIKEQKEINLRVSTESGTERTAQIVFDQKQKKLLRWTE

Nucleotide


Download         Length: 375 bp        

>NTDB_id=265740 C2H97_RS00205 WP_032726157.1 31365..31739(-) (comGG) [Bacillus subtilis PY79 strain PK1_3]
ATGTATCGTACAAGAGGGTTTATTTATCCAGCTGTTCTTTTTGTGTCAGCGCTTGTGCTGTTAATCGTGAACTTTGCTGC
TGCTCAATATATTTCACGCTGCATGTTTGAAAAGGAAACAAAAGAGTTATACATAGGAGAGAATTTGCTTCAAAATGGTA
CGCTTCTTTCGATTCGGCACGTTCTAGAGAAACGGAAAGGCCAGGAGGGTACGCAGCAATTTCCATATGGACGGGTTTCT
TATTACATTCATGATACATCGATAAAAGAGCAAAAAGAAATCAACTTAAGAGTGTCAACGGAGTCGGGAACAGAAAGAAC
TGCACAGATCGTGTTTGATCAAAAACAGAAAAAACTGCTGAGATGGACAGAATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

95.968

100

0.96

Multiple sequence alignment