Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   C2H97_RS00170 Genome accession   NZ_CP026038
Coordinates   27674..27847 (+) Length   57 a.a.
NCBI ID   WP_014477323.1    Uniprot ID   -
Organism   Bacillus subtilis PY79 strain PK1_3     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 22674..32847
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  C2H97_RS00155 (C2H97_00155) gcvT 23472..24560 (-) 1089 WP_038829737.1 glycine cleavage system aminomethyltransferase GcvT -
  C2H97_RS00160 (C2H97_00160) yqhH 25002..26675 (+) 1674 WP_120028360.1 SNF2-related protein -
  C2H97_RS00165 (C2H97_00165) yqhG 26696..27490 (+) 795 WP_032726154.1 YqhG family protein -
  C2H97_RS00170 (C2H97_00175) sinI 27674..27847 (+) 174 WP_014477323.1 anti-repressor SinI Regulator
  C2H97_RS00175 (C2H97_00180) sinR 27881..28216 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  C2H97_RS00180 (C2H97_00185) tasA 28308..29093 (-) 786 WP_014477324.1 biofilm matrix protein TasA -
  C2H97_RS00185 (C2H97_00190) sipW 29158..29730 (-) 573 WP_003246088.1 signal peptidase I SipW -
  C2H97_RS00190 (C2H97_00195) tapA 29714..30475 (-) 762 WP_120028361.1 amyloid fiber anchoring/assembly protein TapA -
  C2H97_RS00195 (C2H97_00200) yqzG 30746..31072 (+) 327 WP_038829733.1 YqzG/YhdC family protein -
  C2H97_RS00200 (C2H97_00205) spoIIT 31114..31293 (-) 180 WP_003230176.1 YqzE family protein -
  C2H97_RS00205 (C2H97_00210) comGG 31365..31739 (-) 375 WP_032726157.1 ComG operon protein ComGG Machinery gene
  C2H97_RS00210 (C2H97_00215) comGF 31740..32123 (-) 384 WP_070547529.1 ComG operon protein ComGF Machinery gene
  C2H97_RS00215 (C2H97_00220) comGE 32149..32496 (-) 348 WP_070547530.1 ComG operon protein 5 Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6633.58 Da        Isoelectric Point: 6.7231

>NTDB_id=265738 C2H97_RS00170 WP_014477323.1 27674..27847(+) (sinI) [Bacillus subtilis PY79 strain PK1_3]
MKNAKQEHFELDQEWVELMMEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=265738 C2H97_RS00170 WP_014477323.1 27674..27847(+) (sinI) [Bacillus subtilis PY79 strain PK1_3]
ATGAAAAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTGATGATGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

98.246

100

0.982

Multiple sequence alignment