Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   C0W57_RS04260 Genome accession   NZ_CP025939
Coordinates   754185..754562 (+) Length   125 a.a.
NCBI ID   WP_017418138.1    Uniprot ID   -
Organism   Bacillus velezensis strain 10075     
Function   assembly of the pseudopilus; dsDNA binding to the cell surface (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 749185..759562
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  C0W57_RS04225 (C0W57_04225) - 749500..750450 (+) 951 WP_014418379.1 magnesium transporter CorA family protein -
  C0W57_RS04230 (C0W57_04230) comGA 750643..751713 (+) 1071 WP_014418378.1 competence type IV pilus ATPase ComGA Machinery gene
  C0W57_RS04235 (C0W57_04235) comGB 751700..752737 (+) 1038 WP_014418377.1 competence type IV pilus assembly protein ComGB Machinery gene
  C0W57_RS04240 (C0W57_04240) comGC 752742..753050 (+) 309 WP_014418376.1 competence type IV pilus major pilin ComGC Machinery gene
  C0W57_RS04245 (C0W57_04245) comGD 753040..753477 (+) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  C0W57_RS04250 (C0W57_04250) comGE 753461..753775 (+) 315 WP_029973875.1 competence type IV pilus minor pilin ComGE Machinery gene
  C0W57_RS04255 (C0W57_04255) comGF 753720..754184 (+) 465 WP_233717055.1 competence type IV pilus minor pilin ComGF -
  C0W57_RS04260 (C0W57_04260) comGG 754185..754562 (+) 378 WP_017418138.1 competence type IV pilus minor pilin ComGG Machinery gene
  C0W57_RS04265 (C0W57_04265) - 754619..754798 (+) 180 WP_003153093.1 YqzE family protein -
  C0W57_RS04270 (C0W57_04270) - 754839..755168 (-) 330 WP_012117979.1 DUF3889 domain-containing protein -
  C0W57_RS04275 (C0W57_04275) tapA 755427..756098 (+) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  C0W57_RS04280 (C0W57_04280) sipW 756070..756654 (+) 585 WP_012117977.1 signal peptidase I SipW -
  C0W57_RS04285 (C0W57_04285) tasA 756719..757504 (+) 786 WP_007408329.1 biofilm matrix protein TasA -
  C0W57_RS04290 (C0W57_04290) sinR 757552..757887 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  C0W57_RS04295 (C0W57_04295) sinI 757921..758094 (-) 174 WP_014418369.1 anti-repressor SinI Regulator
  C0W57_RS04300 (C0W57_04300) - 758271..759065 (-) 795 WP_014418368.1 YqhG family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14125.01 Da        Isoelectric Point: 9.7165

>NTDB_id=264610 C0W57_RS04260 WP_017418138.1 754185..754562(+) (comGG) [Bacillus velezensis strain 10075]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMTQGQKGQTGTQRFPYGTVS
FHITGSDRRETVQVTIQAETTTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=264610 C0W57_RS04260 WP_017418138.1 754185..754562(+) (comGG) [Bacillus velezensis strain 10075]
ATGTACAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCCGGGGAGTACTGGATCGGAGAGAACCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGGCCAAACTGGTACACAGCGTTTTCCGTACGGCACCGTTTCT
TTTCACATCACCGGGAGTGATCGAAGGGAAACGGTTCAGGTTACAATTCAGGCGGAAACCACGACAGGCACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

51.613

99.2

0.512

Multiple sequence alignment