Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | C0W57_RS04295 | Genome accession | NZ_CP025939 |
| Coordinates | 757921..758094 (-) | Length | 57 a.a. |
| NCBI ID | WP_014418369.1 | Uniprot ID | I2C7P2 |
| Organism | Bacillus velezensis strain 10075 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 752921..763094
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C0W57_RS04245 (C0W57_04245) | comGD | 753040..753477 (+) | 438 | WP_007612572.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| C0W57_RS04250 (C0W57_04250) | comGE | 753461..753775 (+) | 315 | WP_029973875.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| C0W57_RS04255 (C0W57_04255) | comGF | 753720..754184 (+) | 465 | WP_233717055.1 | competence type IV pilus minor pilin ComGF | - |
| C0W57_RS04260 (C0W57_04260) | comGG | 754185..754562 (+) | 378 | WP_017418138.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| C0W57_RS04265 (C0W57_04265) | - | 754619..754798 (+) | 180 | WP_003153093.1 | YqzE family protein | - |
| C0W57_RS04270 (C0W57_04270) | - | 754839..755168 (-) | 330 | WP_012117979.1 | DUF3889 domain-containing protein | - |
| C0W57_RS04275 (C0W57_04275) | tapA | 755427..756098 (+) | 672 | WP_014418371.1 | amyloid fiber anchoring/assembly protein TapA | - |
| C0W57_RS04280 (C0W57_04280) | sipW | 756070..756654 (+) | 585 | WP_012117977.1 | signal peptidase I SipW | - |
| C0W57_RS04285 (C0W57_04285) | tasA | 756719..757504 (+) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| C0W57_RS04290 (C0W57_04290) | sinR | 757552..757887 (-) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| C0W57_RS04295 (C0W57_04295) | sinI | 757921..758094 (-) | 174 | WP_014418369.1 | anti-repressor SinI | Regulator |
| C0W57_RS04300 (C0W57_04300) | - | 758271..759065 (-) | 795 | WP_014418368.1 | YqhG family protein | - |
| C0W57_RS04305 (C0W57_04305) | - | 759087..760757 (-) | 1671 | WP_021494309.1 | DEAD/DEAH box helicase | - |
| C0W57_RS04310 (C0W57_04310) | gcvT | 761181..762281 (+) | 1101 | WP_029973877.1 | glycine cleavage system aminomethyltransferase GcvT | - |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6642.60 Da Isoelectric Point: 9.8168
>NTDB_id=264612 C0W57_RS04295 WP_014418369.1 757921..758094(-) (sinI) [Bacillus velezensis strain 10075]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=264612 C0W57_RS04295 WP_014418369.1 757921..758094(-) (sinI) [Bacillus velezensis strain 10075]
ATGAAAAATGCAAAAACAGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAACAGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
71.93 |
100 |
0.719 |