Detailed information    

insolico Bioinformatically predicted

Overview

Name   cipB   Type   Regulator
Locus tag   STER_RS08050 Genome accession   NC_008532
Coordinates   1534032..1534271 (-) Length   79 a.a.
NCBI ID   WP_011681565.1    Uniprot ID   -
Organism   Streptococcus thermophilus LMD-9     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context

Location: 1529032..1539271
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  STER_RS08020 (STER_1634) - 1530756..1531136 (-) 381 WP_002951783.1 hypothetical protein -
  STER_RS11095 - 1531261..1531524 (-) 264 WP_002945924.1 hypothetical protein -
  STER_RS08025 (STER_1636) - 1531846..1532142 (-) 297 WP_004197070.1 bacteriocin immunity protein -
  STER_RS08030 (STER_1637) - 1532307..1532513 (-) 207 WP_011681562.1 hypothetical protein -
  STER_RS08035 (STER_1638) - 1532544..1533236 (-) 693 WP_224103184.1 thioredoxin family protein -
  STER_RS08040 (STER_1639) - 1533420..1533599 (-) 180 WP_011681564.1 hypothetical protein -
  STER_RS08045 (STER_1640) - 1533628..1534020 (-) 393 WP_003094909.1 hypothetical protein -
  STER_RS08050 (STER_1641) cipB 1534032..1534271 (-) 240 WP_011681565.1 Blp family class II bacteriocin Regulator
  STER_RS12290 (STER_1642) - 1534522..1534923 (-) 402 WP_011681566.1 hypothetical protein -
  STER_RS11385 (STER_1645) - 1535778..1535939 (-) 162 WP_011681568.1 hypothetical protein -
  STER_RS08065 (STER_1646) - 1535946..1536176 (-) 231 WP_011226494.1 bacteriocin class II family protein -
  STER_RS08070 (STER_1647) - 1536532..1536732 (-) 201 WP_011681569.1 hypothetical protein -
  STER_RS08075 (STER_1648) - 1536751..1536927 (-) 177 WP_011681570.1 Blp family class II bacteriocin -
  STER_RS08080 (STER_1649) - 1537178..1537915 (+) 738 WP_011681571.1 LytR/AlgR family response regulator transcription factor -
  STER_RS11905 comD/blpH 1538446..1539249 (+) 804 WP_223899638.1 ATP-binding protein Regulator

Sequence

Protein


Download         Length: 79 a.a.        Molecular weight: 7727.69 Da        Isoelectric Point: 3.8735

>NTDB_id=25957 STER_RS08050 WP_011681565.1 1534032..1534271(-) (cipB) [Streptococcus thermophilus LMD-9]
MATQTIENFNTLDLETLASVEGGRVNWERWGMCGASVAVGASEGFSAAAGGTAFFIGPYAIGTGAVGAAIGGGVALLGC

Nucleotide


Download         Length: 240 bp        

>NTDB_id=25957 STER_RS08050 WP_011681565.1 1534032..1534271(-) (cipB) [Streptococcus thermophilus LMD-9]
ATGGCAACTCAAACAATTGAAAACTTTAACACCCTCGACCTTGAAACACTTGCTAGTGTTGAAGGAGGACGAGTCAATTG
GGAACGATGGGGAATGTGTGGGGCCTCTGTCGCCGTAGGTGCTTCAGAAGGATTCTCTGCAGCTGCAGGTGGAACGGCTT
TCTTCATTGGACCGTATGCAATTGGAACTGGTGCAGTAGGTGCAGCTATTGGAGGTGGAGTAGCCTTACTTGGCTGTTAA

Domains

Predicted by InterProScan.

Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc)

(7-74)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

52.459

77.215

0.405

Multiple sequence alignment