Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   HPAG1_RS00215 Genome accession   NC_008086
Coordinates   38692..38805 (+) Length   37 a.a.
NCBI ID   WP_001217873.1    Uniprot ID   G2MCV1
Organism   Helicobacter pylori HPAG1     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 33692..43805
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HPAG1_RS00190 (HPAG1_0031) - 33749..35974 (+) 2226 WP_001051477.1 AAA family ATPase -
  HPAG1_RS00195 (HPAG1_0032) panD 35964..36314 (+) 351 WP_000142242.1 aspartate 1-decarboxylase -
  HPAG1_RS00200 (HPAG1_0033) - 36325..36618 (+) 294 WP_000347917.1 YbaB/EbfC family nucleoid-associated protein -
  HPAG1_RS00205 (HPAG1_0034) - 36618..37613 (+) 996 WP_000902477.1 PDZ domain-containing protein -
  HPAG1_RS00210 (HPAG1_0035) comB6 37621..38676 (+) 1056 WP_000786698.1 P-type conjugative transfer protein TrbL Machinery gene
  HPAG1_RS00215 (HPAG1_0036) comB7 38692..38805 (+) 114 WP_001217873.1 hypothetical protein Machinery gene
  HPAG1_RS00220 (HPAG1_0037) comB8 38802..39545 (+) 744 WP_000660522.1 type IV secretion system protein Machinery gene
  HPAG1_RS00225 (HPAG1_0038) comB9 39545..40522 (+) 978 WP_041200028.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  HPAG1_RS00230 (HPAG1_0039) comB10 40515..41645 (+) 1131 WP_001045873.1 DNA type IV secretion system protein ComB10 Machinery gene
  HPAG1_RS00235 (HPAG1_0040) - 41715..43127 (+) 1413 WP_000694794.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 37 a.a.        Molecular weight: 4325.25 Da        Isoelectric Point: 9.3572

>NTDB_id=25954 HPAG1_RS00215 WP_001217873.1 38692..38805(+) (comB7) [Helicobacter pylori HPAG1]
MRIFFVIMGLVFFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=25954 HPAG1_RS00215 WP_001217873.1 38692..38805(+) (comB7) [Helicobacter pylori HPAG1]
ATGAGAATTTTTTTTGTTATCATGGGACTTGTGTTTTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACCTTGTATGAAAACAGGTTAAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G2MCV1

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

100

100

1


Multiple sequence alignment