Detailed information
Overview
| Name | pilA/pilA1 | Type | Machinery gene |
| Locus tag | DOP62_RS07890 | Genome accession | NZ_CP030139 |
| Coordinates | 1616867..1617016 (+) | Length | 49 a.a. |
| NCBI ID | WP_370538766.1 | Uniprot ID | - |
| Organism | Synechococcus elongatus PCC 11801 | ||
| Function | type IV pilus biogenesis and function (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 1611867..1622016
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DOP62_RS07865 (DOP62_13735) | - | 1612969..1613130 (+) | 162 | WP_208675815.1 | hypothetical protein | - |
| DOP62_RS07870 (DOP62_04070) | argH | 1613238..1614638 (+) | 1401 | WP_208675814.1 | argininosuccinate lyase | - |
| DOP62_RS07875 (DOP62_04065) | - | 1614806..1615117 (+) | 312 | WP_261790002.1 | hypothetical protein | - |
| DOP62_RS07880 (DOP62_04060) | - | 1615114..1616010 (-) | 897 | WP_208675812.1 | TIGR01777 family oxidoreductase | - |
| DOP62_RS07885 (DOP62_04055) | psb28 | 1616028..1616402 (-) | 375 | WP_208675811.1 | photosystem II reaction center protein Psb28 | - |
| DOP62_RS07890 (DOP62_04050) | pilA/pilA1 | 1616867..1617016 (+) | 150 | WP_370538766.1 | prepilin-type N-terminal cleavage/methylation domain-containing protein | Machinery gene |
| DOP62_RS07895 (DOP62_04045) | - | 1617668..1618219 (-) | 552 | WP_208675810.1 | hypothetical protein | - |
| DOP62_RS07900 (DOP62_04040) | - | 1618806..1619024 (+) | 219 | WP_208675808.1 | NAD(P)H-quinone oxidoreductase subunit O | - |
| DOP62_RS07905 (DOP62_04035) | - | 1619096..1619713 (+) | 618 | WP_208675806.1 | hypothetical protein | - |
| DOP62_RS07910 | - | 1619826..1619927 (+) | 102 | Protein_1558 | hypothetical protein | - |
| DOP62_RS07915 (DOP62_13740) | - | 1619949..1620104 (+) | 156 | WP_261790001.1 | DUF29 domain-containing protein | - |
Sequence
Protein
Download Length: 49 a.a. Molecular weight: 5132.95 Da Isoelectric Point: 5.9864
>NTDB_id=259293 DOP62_RS07890 WP_370538766.1 1616867..1617016(+) (pilA/pilA1) [Synechococcus elongatus PCC 11801]
MTRTSRSQGFTITEILIVIIIVGILAAVATPSLAGFVGQQQTNQATSEV
MTRTSRSQGFTITEILIVIIIVGILAAVATPSLAGFVGQQQTNQATSEV
Nucleotide
Download Length: 150 bp
>NTDB_id=259293 DOP62_RS07890 WP_370538766.1 1616867..1617016(+) (pilA/pilA1) [Synechococcus elongatus PCC 11801]
TTGACCCGCACCTCGCGATCCCAAGGTTTTACAATCACTGAAATTTTAATTGTGATTATCATTGTCGGCATTCTGGCAGC
AGTTGCCACACCAAGCTTGGCAGGCTTTGTTGGACAACAACAAACGAATCAAGCTACGAGCGAAGTTTAA
TTGACCCGCACCTCGCGATCCCAAGGTTTTACAATCACTGAAATTTTAATTGTGATTATCATTGTCGGCATTCTGGCAGC
AGTTGCCACACCAAGCTTGGCAGGCTTTGTTGGACAACAACAAACGAATCAAGCTACGAGCGAAGTTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| pilA/pilA1 | Synechocystis sp. PCC 6803 |
42.553 |
95.918 |
0.408 |
| pilE | Neisseria gonorrhoeae MS11 |
50 |
77.551 |
0.388 |
| pilE | Neisseria gonorrhoeae strain FA1090 |
50 |
77.551 |
0.388 |
| pilV | Deinococcus radiodurans R1 = ATCC 13939 = DSM 20539 |
65.517 |
59.184 |
0.388 |
| pilA | Acinetobacter baumannii strain A118 |
42.857 |
85.714 |
0.367 |