Detailed information
Bioinformatically predicted
Overview
| Name | comC | Type | Regulator |
| Locus tag | CWI64_RS06930 | Genome accession | NZ_CP025076 |
| Coordinates | 1290066..1290197 (-) | Length | 43 a.a. |
| NCBI ID | WP_061649796.1 | Uniprot ID | - |
| Organism | Streptococcus pneumoniae strain BHN97x | ||
| Function | binding to ComD; induce autophosphorylation of ComD (predicted from homology) Competence regulation |
||
Genomic Context
Location: 1285066..1295197
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CWI64_RS06900 (CWI64_06900) | - | 1285419..1285961 (+) | 543 | WP_001158266.1 | TetR/AcrR family transcriptional regulator | - |
| CWI64_RS06915 (CWI64_06915) | - | 1286322..1287719 (+) | 1398 | WP_001812112.1 | ISNCY-like element IS1202 family transposase | - |
| CWI64_RS06920 (CWI64_06920) | comE | 1287979..1288731 (-) | 753 | WP_000866075.1 | competence system response regulator transcription factor ComE | Regulator |
| CWI64_RS06925 (CWI64_06925) | comD/comD1 | 1288728..1290053 (-) | 1326 | WP_025169508.1 | competence system sensor histidine kinase ComD | Regulator |
| CWI64_RS06930 (CWI64_06930) | comC | 1290066..1290197 (-) | 132 | WP_061649796.1 | competence-stimulating peptide ComC | Regulator |
| CWI64_RS06940 (CWI64_06940) | rlmH | 1290479..1290958 (-) | 480 | WP_000695929.1 | 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH | - |
| CWI64_RS06945 (CWI64_06945) | htrA | 1291141..1292322 (+) | 1182 | WP_000681598.1 | S1C family serine protease | Regulator |
| CWI64_RS06950 (CWI64_06950) | spo0J | 1292380..1293138 (+) | 759 | WP_000410381.1 | ParB/RepB/Spo0J family partition protein | Regulator |
| CWI64_RS06955 (CWI64_06955) | dnaA | 1293351..1294712 (+) | 1362 | WP_000660615.1 | chromosomal replication initiator protein DnaA | - |
Sequence
Protein
Download Length: 43 a.a. Molecular weight: 5299.18 Da Isoelectric Point: 11.0565
>NTDB_id=258107 CWI64_RS06930 WP_061649796.1 1290066..1290197(-) (comC) [Streptococcus pneumoniae strain BHN97x]
MKNTVKLEQFVALKEKDLQNIQGGEMRKMNEKSFNFFNFFRRR
MKNTVKLEQFVALKEKDLQNIQGGEMRKMNEKSFNFFNFFRRR
Nucleotide
Download Length: 132 bp
>NTDB_id=258107 CWI64_RS06930 WP_061649796.1 1290066..1290197(-) (comC) [Streptococcus pneumoniae strain BHN97x]
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCTTTGAAGGAAAAAGACTTGCAAAATATTCAAGGTGGGGAGATGAG
GAAAATGAATGAAAAGTCCTTTAATTTCTTTAATTTCTTTAGAAGAAGATAA
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCTTTGAAGGAAAAAGACTTGCAAAATATTCAAGGTGGGGAGATGAG
GAAAATGAATGAAAAGTCCTTTAATTTCTTTAATTTCTTTAGAAGAAGATAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comC | Streptococcus mitis NCTC 12261 |
67.442 |
100 |
0.674 |
| comC/comC2 | Streptococcus pneumoniae A66 |
92.593 |
62.791 |
0.581 |
| comC/comC2 | Streptococcus pneumoniae TIGR4 |
92.593 |
62.791 |
0.581 |
| comC/comC1 | Streptococcus pneumoniae R6 |
92.593 |
62.791 |
0.581 |
| comC/comC1 | Streptococcus pneumoniae G54 |
92.593 |
62.791 |
0.581 |
| comC/comC1 | Streptococcus pneumoniae D39 |
92.593 |
62.791 |
0.581 |
| comC/comC1 | Streptococcus pneumoniae Rx1 |
92.593 |
62.791 |
0.581 |
| comC | Streptococcus mitis SK321 |
92.593 |
62.791 |
0.581 |