Detailed information NTG0257084

Bioinformatically predicted

Overview

• Name: comGD
• Type: Machinery gene
• Locus tag: CWD84_RS09435
• Genome accession: NZ_CP025001
• Coordinates: 1734499..1734936 (+)
• Length: 145 a.a.
• NCBI ID: WP_060964765.1
• Uniprot ID: A0AAI8MY59
• Organism: Bacillus siamensis strain SCSIO 05746
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1729499..1739936

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
CWD84_RS09410 (CWD84_09410)	-	1729512..1730813 (-)	1302	WP_060964762.1	hemolysin family protein	-
CWD84_RS09415 (CWD84_09415)	-	1730959..1731909 (+)	951	WP_060964763.1	magnesium transporter CorA family protein	-
CWD84_RS09420 (CWD84_09420)	comGA	1732102..1733172 (+)	1071	WP_045926720.1	competence type IV pilus ATPase ComGA	Machinery gene
CWD84_RS09425 (CWD84_09425)	comGB	1733159..1734196 (+)	1038	WP_060964764.1	competence type IV pilus assembly protein ComGB	Machinery gene
CWD84_RS09430 (CWD84_09430)	comGC	1734201..1734509 (+)	309	WP_016938966.1	competence type IV pilus major pilin ComGC	Machinery gene
CWD84_RS09435 (CWD84_09435)	comGD	1734499..1734936 (+)	438	WP_060964765.1	competence type IV pilus minor pilin ComGD	Machinery gene
CWD84_RS09440 (CWD84_09440)	comGE	1734920..1735234 (+)	315	WP_060964766.1	competence type IV pilus minor pilin ComGE	Machinery gene
CWD84_RS09445 (CWD84_09445)	comGF	1735146..1735643 (+)	498	WP_235588382.1	competence type IV pilus minor pilin ComGF	-
CWD84_RS09450 (CWD84_09450)	comGG	1735644..1736021 (+)	378	WP_060964768.1	competence type IV pilus minor pilin ComGG	Machinery gene
CWD84_RS09455 (CWD84_09455)	-	1736078..1736257 (+)	180	WP_022552966.1	YqzE family protein	-
CWD84_RS09460 (CWD84_09460)	-	1736298..1736627 (-)	330	WP_016938972.1	DUF3889 domain-containing protein	-
CWD84_RS09465 (CWD84_09465)	tapA	1736886..1737557 (+)	672	WP_060964769.1	amyloid fiber anchoring/assembly protein TapA	-
CWD84_RS09470 (CWD84_09470)	sipW	1737529..1738113 (+)	585	WP_060964770.1	signal peptidase I SipW	-
CWD84_RS09475 (CWD84_09475)	tasA	1738177..1738962 (+)	786	WP_016938976.1	biofilm matrix protein TasA	-
CWD84_RS09480 (CWD84_09480)	sinR	1739010..1739345 (-)	336	WP_003226345.1	transcriptional regulator SinR	Regulator
CWD84_RS09485 (CWD84_09485)	sinI	1739379..1739552 (-)	174	WP_016938977.1	anti-repressor SinI	Regulator

Sequence

Protein

• Length: 145 a.a.
• Molecular weight: 16315.85 Da
• Isoelectric Point: 9.6949

>NTDB_id=257084 CWD84_RS09435 WP_060964765.1 1734499..1734936(+) (comGD) [Bacillus siamensis strain SCSIO 05746]
MNNNRLTESGFTLLESLIVLSLASVLLTVLFTALPPVYTHLTVRQKTEQLQKDIQLVQETAVAEHKRTKIIFLPKEHKYK
FQSAGKAVERSFDSLHMTLMTLPESLEFNEKGHPNSGGKIQLKHAGVTYEITVYLGSGNVHAERK

Nucleotide

• Length: 438 bp

>NTDB_id=257084 CWD84_RS09435 WP_060964765.1 1734499..1734936(+) (comGD) [Bacillus siamensis strain SCSIO 05746]
TTGAACAATAACAGGCTGACAGAAAGCGGATTCACGCTTCTTGAAAGCCTGATTGTGTTAAGCCTGGCGTCCGTTCTGCT
GACGGTCTTGTTCACGGCGCTTCCTCCGGTTTATACCCATCTGACCGTTCGGCAAAAAACAGAACAGCTCCAAAAAGATA
TTCAGCTTGTTCAGGAAACGGCTGTCGCAGAGCATAAAAGAACAAAAATCATTTTTCTCCCCAAAGAGCATAAATACAAG
TTCCAGTCAGCCGGAAAGGCTGTCGAGCGTTCATTTGATTCGCTTCATATGACACTTATGACCTTGCCGGAGAGCCTTGA
ATTTAATGAAAAAGGCCATCCGAATTCCGGCGGAAAGATTCAATTGAAGCACGCAGGGGTCACTTATGAAATAACAGTTT
ACCTAGGGAGCGGAAATGTCCATGCAGAACGGAAGTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (8-31)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGD	Bacillus subtilis subsp. subtilis str. 168	55.396	95.862	0.531