Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGE   Type   Machinery gene
Locus tag   CWD84_RS09440 Genome accession   NZ_CP025001
Coordinates   1734920..1735234 (+) Length   104 a.a.
NCBI ID   WP_060964766.1    Uniprot ID   A0AAI8MZY1
Organism   Bacillus siamensis strain SCSIO 05746     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 1729920..1740234
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CWD84_RS09415 (CWD84_09415) - 1730959..1731909 (+) 951 WP_060964763.1 magnesium transporter CorA family protein -
  CWD84_RS09420 (CWD84_09420) comGA 1732102..1733172 (+) 1071 WP_045926720.1 competence type IV pilus ATPase ComGA Machinery gene
  CWD84_RS09425 (CWD84_09425) comGB 1733159..1734196 (+) 1038 WP_060964764.1 competence type IV pilus assembly protein ComGB Machinery gene
  CWD84_RS09430 (CWD84_09430) comGC 1734201..1734509 (+) 309 WP_016938966.1 competence type IV pilus major pilin ComGC Machinery gene
  CWD84_RS09435 (CWD84_09435) comGD 1734499..1734936 (+) 438 WP_060964765.1 competence type IV pilus minor pilin ComGD Machinery gene
  CWD84_RS09440 (CWD84_09440) comGE 1734920..1735234 (+) 315 WP_060964766.1 competence type IV pilus minor pilin ComGE Machinery gene
  CWD84_RS09445 (CWD84_09445) comGF 1735146..1735643 (+) 498 WP_235588382.1 competence type IV pilus minor pilin ComGF -
  CWD84_RS09450 (CWD84_09450) comGG 1735644..1736021 (+) 378 WP_060964768.1 competence type IV pilus minor pilin ComGG Machinery gene
  CWD84_RS09455 (CWD84_09455) - 1736078..1736257 (+) 180 WP_022552966.1 YqzE family protein -
  CWD84_RS09460 (CWD84_09460) - 1736298..1736627 (-) 330 WP_016938972.1 DUF3889 domain-containing protein -
  CWD84_RS09465 (CWD84_09465) tapA 1736886..1737557 (+) 672 WP_060964769.1 amyloid fiber anchoring/assembly protein TapA -
  CWD84_RS09470 (CWD84_09470) sipW 1737529..1738113 (+) 585 WP_060964770.1 signal peptidase I SipW -
  CWD84_RS09475 (CWD84_09475) tasA 1738177..1738962 (+) 786 WP_016938976.1 biofilm matrix protein TasA -
  CWD84_RS09480 (CWD84_09480) sinR 1739010..1739345 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  CWD84_RS09485 (CWD84_09485) sinI 1739379..1739552 (-) 174 WP_016938977.1 anti-repressor SinI Regulator

Sequence

Protein


Download         Length: 104 a.a.        Molecular weight: 11885.84 Da        Isoelectric Point: 7.7788

>NTDB_id=257085 CWD84_RS09440 WP_060964766.1 1734920..1735234(+) (comGE) [Bacillus siamensis strain SCSIO 05746]
MQNGSKGFSTIETLSAMAIWLFLMISIVPVWTDLLTDNLKTEERQKARQLLQERISAYMMSGKKQPSPGVTWKEEGDYYK
VCAAVRGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=257085 CWD84_RS09440 WP_060964766.1 1734920..1735234(+) (comGE) [Bacillus siamensis strain SCSIO 05746]
ATGCAGAACGGAAGTAAAGGATTCTCTACTATTGAAACACTATCAGCAATGGCCATTTGGCTGTTTCTTATGATTTCTAT
CGTTCCGGTCTGGACGGACCTGCTGACGGATAATCTAAAAACAGAGGAACGCCAAAAAGCGCGCCAGCTTCTCCAGGAAC
GCATCAGCGCTTATATGATGTCCGGAAAAAAGCAGCCGTCTCCCGGTGTGACGTGGAAGGAGGAAGGTGATTATTACAAA
GTCTGTGCGGCTGTCCGCGGCGAAAAAGAAATGTGTCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

45.946

100

0.49

Multiple sequence alignment