Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   CWD84_RS09485 Genome accession   NZ_CP025001
Coordinates   1739379..1739552 (-) Length   57 a.a.
NCBI ID   WP_016938977.1    Uniprot ID   -
Organism   Bacillus siamensis strain SCSIO 05746     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 1734379..1744552
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CWD84_RS09435 (CWD84_09435) comGD 1734499..1734936 (+) 438 WP_060964765.1 competence type IV pilus minor pilin ComGD Machinery gene
  CWD84_RS09440 (CWD84_09440) comGE 1734920..1735234 (+) 315 WP_060964766.1 competence type IV pilus minor pilin ComGE Machinery gene
  CWD84_RS09445 (CWD84_09445) comGF 1735146..1735643 (+) 498 WP_235588382.1 competence type IV pilus minor pilin ComGF -
  CWD84_RS09450 (CWD84_09450) comGG 1735644..1736021 (+) 378 WP_060964768.1 competence type IV pilus minor pilin ComGG Machinery gene
  CWD84_RS09455 (CWD84_09455) - 1736078..1736257 (+) 180 WP_022552966.1 YqzE family protein -
  CWD84_RS09460 (CWD84_09460) - 1736298..1736627 (-) 330 WP_016938972.1 DUF3889 domain-containing protein -
  CWD84_RS09465 (CWD84_09465) tapA 1736886..1737557 (+) 672 WP_060964769.1 amyloid fiber anchoring/assembly protein TapA -
  CWD84_RS09470 (CWD84_09470) sipW 1737529..1738113 (+) 585 WP_060964770.1 signal peptidase I SipW -
  CWD84_RS09475 (CWD84_09475) tasA 1738177..1738962 (+) 786 WP_016938976.1 biofilm matrix protein TasA -
  CWD84_RS09480 (CWD84_09480) sinR 1739010..1739345 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  CWD84_RS09485 (CWD84_09485) sinI 1739379..1739552 (-) 174 WP_016938977.1 anti-repressor SinI Regulator
  CWD84_RS09490 (CWD84_09490) - 1739729..1740523 (-) 795 WP_060964771.1 YqhG family protein -
  CWD84_RS09495 (CWD84_09495) - 1740545..1742215 (-) 1671 WP_060964772.1 DEAD/DEAH box helicase -
  CWD84_RS09500 (CWD84_09500) gcvT 1742639..1743739 (+) 1101 WP_060964773.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6719.70 Da        Isoelectric Point: 9.8173

>NTDB_id=257088 CWD84_RS09485 WP_016938977.1 1739379..1739552(-) (sinI) [Bacillus siamensis strain SCSIO 05746]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLHSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=257088 CWD84_RS09485 WP_016938977.1 1739379..1739552(-) (sinI) [Bacillus siamensis strain SCSIO 05746]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCTCAAAAAGCAAATAT
CAGCCTGGAAGAAATACGCAAATACCTGCATTCGCATAAAAAGTCTTCTCAACATATCCAGGCCGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

68.421

100

0.684

Multiple sequence alignment