Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   CV728_RS07680 Genome accession   NZ_CP024948
Coordinates   1578569..1578682 (-) Length   37 a.a.
NCBI ID   WP_001217873.1    Uniprot ID   G2MCV1
Organism   Helicobacter pylori strain B140     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 1573569..1583682
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CV728_RS07660 (CV728_07680) - 1574234..1575646 (-) 1413 WP_145818068.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -
  CV728_RS07665 (CV728_07685) comB10 1575717..1576853 (-) 1137 WP_145818069.1 DNA type IV secretion system protein ComB10 Machinery gene
  CV728_RS07670 (CV728_07690) comB9 1576846..1577829 (-) 984 WP_145818070.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  CV728_RS07675 (CV728_07695) comB8 1577829..1578572 (-) 744 WP_128036478.1 virB8 family protein Machinery gene
  CV728_RS07680 (CV728_07700) comB7 1578569..1578682 (-) 114 WP_001217873.1 hypothetical protein Machinery gene
  CV728_RS07685 (CV728_07705) comB6 1578698..1579753 (-) 1056 WP_145818311.1 P-type conjugative transfer protein TrbL Machinery gene
  CV728_RS07690 (CV728_07710) - 1579761..1580765 (-) 1005 WP_145818313.1 PDZ domain-containing protein -
  CV728_RS07695 (CV728_07715) - 1580765..1581067 (-) 303 WP_145818071.1 YbaB/EbfC family nucleoid-associated protein -
  CV728_RS07700 (CV728_07720) panD 1581070..1581423 (-) 354 WP_145818072.1 aspartate 1-decarboxylase -
  CV728_RS07705 (CV728_07725) - 1581413..1583638 (-) 2226 WP_145818074.1 ATP-dependent Clp protease ATP-binding subunit -

Sequence


Protein


Download         Length: 37 a.a.        Molecular weight: 4325.25 Da        Isoelectric Point: 9.3572

>NTDB_id=256584 CV728_RS07680 WP_001217873.1 1578569..1578682(-) (comB7) [Helicobacter pylori strain B140]
MRIFFVIMGLVFFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=256584 CV728_RS07680 WP_001217873.1 1578569..1578682(-) (comB7) [Helicobacter pylori strain B140]
ATGAGAATTTTTTTTGTTATCATGGGACTTGTGTTTTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACCTTGTATGAAAACAGGTTAAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

100

100

1


Multiple sequence alignment