Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   CV729_RS01210 Genome accession   NZ_CP024947
Coordinates   240904..241017 (+) Length   37 a.a.
NCBI ID   WP_001217873.1    Uniprot ID   G2MCV1
Organism   Helicobacter pylori strain J182     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 235904..246017
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CV729_RS01185 (CV729_01180) - 235961..238186 (+) 2226 WP_145731658.1 ATP-dependent Clp protease ATP-binding subunit -
  CV729_RS01190 (CV729_01185) panD 238176..238526 (+) 351 WP_108593697.1 aspartate 1-decarboxylase -
  CV729_RS01195 (CV729_01190) - 238537..238830 (+) 294 WP_000347917.1 YbaB/EbfC family nucleoid-associated protein -
  CV729_RS01200 (CV729_01195) - 238830..239825 (+) 996 WP_145731660.1 PDZ domain-containing protein -
  CV729_RS01205 (CV729_01200) comB6 239833..240888 (+) 1056 WP_145731661.1 P-type conjugative transfer protein TrbL Machinery gene
  CV729_RS01210 (CV729_01205) comB7 240904..241017 (+) 114 WP_001217873.1 hypothetical protein Machinery gene
  CV729_RS01215 (CV729_01210) comB8 241014..241751 (+) 738 WP_145731663.1 virB8 family protein Machinery gene
  CV729_RS01220 (CV729_01215) comB9 241751..242737 (+) 987 WP_145731664.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  CV729_RS01225 (CV729_01220) comB10 242730..243866 (+) 1137 WP_145731666.1 DNA type IV secretion system protein ComB10 Machinery gene
  CV729_RS01230 (CV729_01225) - 243936..245348 (+) 1413 WP_145731668.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 37 a.a.        Molecular weight: 4325.25 Da        Isoelectric Point: 9.3572

>NTDB_id=256554 CV729_RS01210 WP_001217873.1 240904..241017(+) (comB7) [Helicobacter pylori strain J182]
MRIFFVIMGLVFFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=256554 CV729_RS01210 WP_001217873.1 240904..241017(+) (comB7) [Helicobacter pylori strain J182]
ATGAGAATTTTTTTTGTTATTATGGGACTTGTGTTTTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGTATGAAAACAGGTTAAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G2MCV1

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

100

100

1


Multiple sequence alignment