Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGD   Type   Machinery gene
Locus tag   CRH11_RS17435 Genome accession   NZ_CP023859
Coordinates   3508492..3508929 (-) Length   145 a.a.
NCBI ID   WP_043020787.1    Uniprot ID   -
Organism   Bacillus velezensis strain L-1     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 3503492..3513929
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CRH11_RS17385 (CRH11_17380) sinI 3503876..3504049 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  CRH11_RS17390 (CRH11_17385) sinR 3504083..3504418 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  CRH11_RS17395 (CRH11_17390) tasA 3504466..3505251 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  CRH11_RS17400 (CRH11_17395) sipW 3505316..3505900 (-) 585 WP_015240205.1 signal peptidase I SipW -
  CRH11_RS17405 (CRH11_17400) tapA 3505872..3506543 (-) 672 WP_020954230.1 amyloid fiber anchoring/assembly protein TapA -
  CRH11_RS17410 (CRH11_17405) - 3506802..3507131 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  CRH11_RS17415 (CRH11_17410) - 3507171..3507350 (-) 180 WP_003153093.1 YqzE family protein -
  CRH11_RS17420 (CRH11_17415) comGG 3507407..3507784 (-) 378 WP_012117980.1 competence type IV pilus minor pilin ComGG Machinery gene
  CRH11_RS17425 (CRH11_17420) comGF 3507785..3508285 (-) 501 WP_257899725.1 competence type IV pilus minor pilin ComGF -
  CRH11_RS17430 (CRH11_17425) comGE 3508194..3508508 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  CRH11_RS17435 (CRH11_17430) comGD 3508492..3508929 (-) 438 WP_043020787.1 competence type IV pilus minor pilin ComGD Machinery gene
  CRH11_RS17440 (CRH11_17435) comGC 3508919..3509227 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  CRH11_RS17445 (CRH11_17440) comGB 3509232..3510269 (-) 1038 WP_094031834.1 competence type IV pilus assembly protein ComGB Machinery gene
  CRH11_RS17450 (CRH11_17445) comGA 3510256..3511326 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  CRH11_RS17455 (CRH11_17450) - 3511520..3512470 (-) 951 WP_007408319.1 magnesium transporter CorA family protein -
  CRH11_RS17460 (CRH11_17455) - 3512616..3513917 (+) 1302 WP_021494315.1 hemolysin family protein -

Sequence


Protein


Download         Length: 145 a.a.        Molecular weight: 16271.77 Da        Isoelectric Point: 10.2475

>NTDB_id=250580 CRH11_RS17435 WP_043020787.1 3508492..3508929(-) (comGD) [Bacillus velezensis strain L-1]
MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPAYTHLAVRQKTELLQKDIQLAQETAIAEHKRTKITFLPKEHKYK
LQSGGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIQLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide


Download         Length: 438 bp        

>NTDB_id=250580 CRH11_RS17435 WP_043020787.1 3508492..3508929(-) (comGD) [Bacillus velezensis strain L-1]
TTGAACAATAACAGGCGGACAGAAAATGGGTTTACCCTTCTTGAAAGCCTGATTGTGTTAAGCCTGGCGTCCGTCCTGCT
GACGGTTTTGTTCACGACGGTTCCGCCGGCCTACACCCACCTTGCCGTGCGGCAAAAAACAGAACTGCTCCAAAAAGATA
TTCAGCTTGCTCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAAAGAGCATAAATACAAA
CTGCAGTCAGGCGGAAGGATTGTCGAGCGTTCTTTTGACTCGCTTCACATTACACTTGTGACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATTCAATTGAAGAGCGCCGGGTTCACCTATGAGATCACAGTTT
ACTTAGGGAGCGGAAATGTTCATGCTAAACGGAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Bacillus subtilis subsp. subtilis str. 168

56.164

100

0.566


Multiple sequence alignment