Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | CRH11_RS17385 | Genome accession | NZ_CP023859 |
| Coordinates | 3503876..3504049 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain L-1 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 3498876..3509049
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CRH11_RS17370 (CRH11_17365) | gcvT | 3499689..3500789 (-) | 1101 | WP_099320056.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| CRH11_RS17375 (CRH11_17370) | - | 3501213..3502883 (+) | 1671 | WP_031378948.1 | DEAD/DEAH box helicase | - |
| CRH11_RS17380 (CRH11_17375) | - | 3502905..3503699 (+) | 795 | WP_007408330.1 | YqhG family protein | - |
| CRH11_RS17385 (CRH11_17380) | sinI | 3503876..3504049 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| CRH11_RS17390 (CRH11_17385) | sinR | 3504083..3504418 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| CRH11_RS17395 (CRH11_17390) | tasA | 3504466..3505251 (-) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| CRH11_RS17400 (CRH11_17395) | sipW | 3505316..3505900 (-) | 585 | WP_015240205.1 | signal peptidase I SipW | - |
| CRH11_RS17405 (CRH11_17400) | tapA | 3505872..3506543 (-) | 672 | WP_020954230.1 | amyloid fiber anchoring/assembly protein TapA | - |
| CRH11_RS17410 (CRH11_17405) | - | 3506802..3507131 (+) | 330 | WP_012117979.1 | DUF3889 domain-containing protein | - |
| CRH11_RS17415 (CRH11_17410) | - | 3507171..3507350 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| CRH11_RS17420 (CRH11_17415) | comGG | 3507407..3507784 (-) | 378 | WP_012117980.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| CRH11_RS17425 (CRH11_17420) | comGF | 3507785..3508285 (-) | 501 | WP_257899725.1 | competence type IV pilus minor pilin ComGF | - |
| CRH11_RS17430 (CRH11_17425) | comGE | 3508194..3508508 (-) | 315 | WP_012117982.1 | competence type IV pilus minor pilin ComGE | - |
| CRH11_RS17435 (CRH11_17430) | comGD | 3508492..3508929 (-) | 438 | WP_043020787.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=250577 CRH11_RS17385 WP_003153105.1 3503876..3504049(+) (sinI) [Bacillus velezensis strain L-1]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=250577 CRH11_RS17385 WP_003153105.1 3503876..3504049(+) (sinI) [Bacillus velezensis strain L-1]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |