Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   CRH11_RS17420 Genome accession   NZ_CP023859
Coordinates   3507407..3507784 (-) Length   125 a.a.
NCBI ID   WP_012117980.1    Uniprot ID   -
Organism   Bacillus velezensis strain L-1     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 3502407..3512784
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CRH11_RS17380 (CRH11_17375) - 3502905..3503699 (+) 795 WP_007408330.1 YqhG family protein -
  CRH11_RS17385 (CRH11_17380) sinI 3503876..3504049 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  CRH11_RS17390 (CRH11_17385) sinR 3504083..3504418 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  CRH11_RS17395 (CRH11_17390) tasA 3504466..3505251 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  CRH11_RS17400 (CRH11_17395) sipW 3505316..3505900 (-) 585 WP_015240205.1 signal peptidase I SipW -
  CRH11_RS17405 (CRH11_17400) tapA 3505872..3506543 (-) 672 WP_020954230.1 amyloid fiber anchoring/assembly protein TapA -
  CRH11_RS17410 (CRH11_17405) - 3506802..3507131 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  CRH11_RS17415 (CRH11_17410) - 3507171..3507350 (-) 180 WP_003153093.1 YqzE family protein -
  CRH11_RS17420 (CRH11_17415) comGG 3507407..3507784 (-) 378 WP_012117980.1 competence type IV pilus minor pilin ComGG Machinery gene
  CRH11_RS17425 (CRH11_17420) comGF 3507785..3508285 (-) 501 WP_257899725.1 competence type IV pilus minor pilin ComGF -
  CRH11_RS17430 (CRH11_17425) comGE 3508194..3508508 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  CRH11_RS17435 (CRH11_17430) comGD 3508492..3508929 (-) 438 WP_043020787.1 competence type IV pilus minor pilin ComGD Machinery gene
  CRH11_RS17440 (CRH11_17435) comGC 3508919..3509227 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  CRH11_RS17445 (CRH11_17440) comGB 3509232..3510269 (-) 1038 WP_094031834.1 competence type IV pilus assembly protein ComGB Machinery gene
  CRH11_RS17450 (CRH11_17445) comGA 3510256..3511326 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  CRH11_RS17455 (CRH11_17450) - 3511520..3512470 (-) 951 WP_007408319.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14195.14 Da        Isoelectric Point: 9.7165

>NTDB_id=250579 CRH11_RS17420 WP_012117980.1 3507407..3507784(-) (comGG) [Bacillus velezensis strain L-1]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGVLLSSRHMTQGQKVQTGTQRFPYGTVS
FHITGSDRRETVQVTIQAETTTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=250579 CRH11_RS17420 WP_012117980.1 3507407..3507784(-) (comGG) [Bacillus velezensis strain L-1]
ATGTACAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
GTCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCCGGGGAGTACTGGATCGGAGAGAATCTGCTCCAAAACGGCG
TGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTATGGCACCGTTTCT
TTTCACATCACGGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCGGAAACAACGACAGGAACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

51.613

99.2

0.512

Multiple sequence alignment