Detailed information    

insolico Bioinformatically predicted

Overview

Name   comC/comC1   Type   Regulator
Locus tag   CO687_RS03070 Genome accession   NZ_CP023511
Coordinates   641454..641618 (+) Length   54 a.a.
NCBI ID   WP_080998577.1    Uniprot ID   -
Organism   Streptococcus gordonii strain FDAARGOS_371     
Function   binding to ComD; induce autophosphorylation of ComD (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Genomic island 641454..664393 641454..641618 within 0


Gene organization within MGE regions


Location: 641454..664393
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CO687_RS03070 (CO687_03070) comC/comC1 641454..641618 (+) 165 WP_080998577.1 bacteriocin Regulator
  CO687_RS03075 (CO687_03075) comD/comD2 641631..642992 (+) 1362 WP_301335837.1 competence system sensor histidine kinase ComD Regulator
  CO687_RS03080 (CO687_03080) comE/comE2 642989..643756 (+) 768 WP_008808031.1 competence system response regulator transcription factor ComE Regulator
  CO687_RS03095 (CO687_03095) ychF 644078..645193 (+) 1116 WP_008808030.1 redox-regulated ATPase YchF -
  CO687_RS03100 (CO687_03100) pth 645267..645836 (+) 570 WP_096754921.1 aminoacyl-tRNA hydrolase -
  CO687_RS03105 (CO687_03105) mfd 645829..649332 (+) 3504 WP_096754922.1 transcription-repair coupling factor -
  CO687_RS03110 (CO687_03110) - 649398..649664 (+) 267 WP_012131074.1 RNA-binding S4 domain-containing protein -
  CO687_RS03115 (CO687_03115) - 649657..650025 (+) 369 WP_060970645.1 septum formation initiator family protein -
  CO687_RS03120 (CO687_03120) - 650028..650147 (+) 120 WP_037622626.1 SP_0009 family protein -
  CO687_RS03125 (CO687_03125) - 650147..651427 (+) 1281 WP_045772579.1 serine hydrolase -
  CO687_RS03130 (CO687_03130) tilS 651424..652701 (+) 1278 WP_008808024.1 tRNA lysidine(34) synthetase TilS -
  CO687_RS03135 (CO687_03135) hpt 652706..653248 (+) 543 WP_060970644.1 hypoxanthine phosphoribosyltransferase -
  CO687_RS03140 (CO687_03140) ftsH 653267..655249 (+) 1983 WP_046164766.1 ATP-dependent zinc metalloprotease FtsH -
  CO687_RS03155 (CO687_03155) comR/comR2 655778..656260 (+) 483 WP_048778891.1 sigma-70 family RNA polymerase sigma factor Regulator
  CO687_RS03265 (CO687_03265) mreC 663076..663891 (+) 816 WP_061596025.1 rod shape-determining protein MreC -
  CO687_RS03270 (CO687_03270) mreD 663893..664393 (+) 501 WP_061602340.1 rod shape-determining protein MreD -

Sequence

Protein


Download         Length: 54 a.a.        Molecular weight: 6369.44 Da        Isoelectric Point: 11.2504

>NTDB_id=247942 CO687_RS03070 WP_080998577.1 641454..641618(+) (comC/comC1) [Streptococcus gordonii strain FDAARGOS_371]
MKKKNKQNLLPKELQQFEILTDNKLQTVIGGSQKGVYASQRSFVPSWFRKIFRN

Nucleotide


Download         Length: 165 bp        

>NTDB_id=247942 CO687_RS03070 WP_080998577.1 641454..641618(+) (comC/comC1) [Streptococcus gordonii strain FDAARGOS_371]
ATGAAAAAGAAAAACAAACAAAATTTATTGCCAAAAGAGTTACAACAATTTGAAATTTTGACAGATAATAAACTTCAAAC
AGTCATTGGGGGATCTCAAAAAGGTGTTTATGCCAGTCAGAGATCATTTGTTCCAAGTTGGTTCCGTAAAATTTTTAGAA
ATTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comC/comC1 Streptococcus gordonii str. Challis substr. CH1

55.556

100

0.556
  comC/comC2 Streptococcus gordonii strain NCTC7865

81.25

59.259

0.481

Multiple sequence alignment