Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGD   Type   Machinery gene
Locus tag   CLI98_RS01700 Genome accession   NZ_CP023431
Coordinates   344443..344880 (-) Length   145 a.a.
NCBI ID   WP_007612572.1    Uniprot ID   -
Organism   Bacillus velezensis strain SCGB 574     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 339443..349880
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CLI98_RS01650 (CLI98_00325) sinI 339826..339999 (+) 174 WP_014418369.1 anti-repressor SinI Regulator
  CLI98_RS01655 (CLI98_00326) sinR 340033..340368 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  CLI98_RS01660 (CLI98_00327) tasA 340416..341201 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  CLI98_RS01665 (CLI98_00328) sipW 341266..341850 (-) 585 WP_022552967.1 signal peptidase I SipW -
  CLI98_RS01670 (CLI98_00329) tapA 341822..342493 (-) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  CLI98_RS01675 (CLI98_00330) - 342752..343081 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  CLI98_RS01680 (CLI98_00331) - 343122..343301 (-) 180 WP_022552966.1 YqzE family protein -
  CLI98_RS01685 (CLI98_00332) comGG 343358..343735 (-) 378 WP_022552965.1 competence type IV pilus minor pilin ComGG Machinery gene
  CLI98_RS01690 (CLI98_00333) comGF 343736..344131 (-) 396 WP_046559876.1 competence type IV pilus minor pilin ComGF -
  CLI98_RS01695 (CLI98_00334) comGE 344145..344459 (-) 315 WP_021494312.1 competence type IV pilus minor pilin ComGE Machinery gene
  CLI98_RS01700 (CLI98_00335) comGD 344443..344880 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  CLI98_RS01705 (CLI98_00336) comGC 344870..345136 (-) 267 WP_050496152.1 competence type IV pilus major pilin ComGC Machinery gene
  CLI98_RS01710 (CLI98_00337) comGB 345183..346220 (-) 1038 WP_022552962.1 competence type IV pilus assembly protein ComGB Machinery gene
  CLI98_RS01715 (CLI98_00338) comGA 346207..347277 (-) 1071 WP_014418378.1 competence type IV pilus ATPase ComGA Machinery gene
  CLI98_RS01720 (CLI98_00339) - 347470..348420 (-) 951 WP_014418379.1 magnesium transporter CorA family protein -
  CLI98_RS01725 (CLI98_00340) - 348566..349867 (+) 1302 WP_022552961.1 hemolysin family protein -

Sequence


Protein


Download         Length: 145 a.a.        Molecular weight: 16254.76 Da        Isoelectric Point: 10.1850

>NTDB_id=247042 CLI98_RS01700 WP_007612572.1 344443..344880(-) (comGD) [Bacillus velezensis strain SCGB 574]
MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPVCTHLAVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPKEHKYK
LQSGGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIQLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide


Download         Length: 438 bp        

>NTDB_id=247042 CLI98_RS01700 WP_007612572.1 344443..344880(-) (comGD) [Bacillus velezensis strain SCGB 574]
TTGAACAATAACAGGCGGACAGAAAATGGGTTTACCCTACTTGAAAGCCTGATTGTGTTAAGCCTGGCGTCCGTCCTGCT
GACGGTTTTGTTCACGACGGTTCCGCCGGTCTGCACCCACCTTGCCGTGCGGCAAAAAACAGAACAGCTCCAAAAAGATA
TTCAGCTTGCTCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAAAGAGCATAAATACAAA
CTGCAGTCAGGCGGAAGGATTGTCGAGCGTTCTTTTGATTCGCTTCACATTACGCTTGTGACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATTCAATTGAAGAGCGCCGGGTTCACCTATGAGATAACAGTTT
ACTTAGGGAGCGGAAATGTCCATGCTAAACGGAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Bacillus subtilis subsp. subtilis str. 168

55.479

100

0.559


Multiple sequence alignment