Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | CLI98_RS01650 | Genome accession | NZ_CP023431 |
| Coordinates | 339826..339999 (+) | Length | 57 a.a. |
| NCBI ID | WP_014418369.1 | Uniprot ID | I2C7P2 |
| Organism | Bacillus velezensis strain SCGB 574 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 334826..344999
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CLI98_RS01635 (CLI98_00322) | gcvT | 335639..336739 (-) | 1101 | WP_017418134.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| CLI98_RS01640 (CLI98_00323) | - | 337163..338833 (+) | 1671 | WP_038461530.1 | SNF2-related protein | - |
| CLI98_RS01645 (CLI98_00324) | - | 338855..339649 (+) | 795 | WP_014418368.1 | YqhG family protein | - |
| CLI98_RS01650 (CLI98_00325) | sinI | 339826..339999 (+) | 174 | WP_014418369.1 | anti-repressor SinI | Regulator |
| CLI98_RS01655 (CLI98_00326) | sinR | 340033..340368 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| CLI98_RS01660 (CLI98_00327) | tasA | 340416..341201 (-) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| CLI98_RS01665 (CLI98_00328) | sipW | 341266..341850 (-) | 585 | WP_022552967.1 | signal peptidase I SipW | - |
| CLI98_RS01670 (CLI98_00329) | tapA | 341822..342493 (-) | 672 | WP_014418371.1 | amyloid fiber anchoring/assembly protein TapA | - |
| CLI98_RS01675 (CLI98_00330) | - | 342752..343081 (+) | 330 | WP_012117979.1 | DUF3889 domain-containing protein | - |
| CLI98_RS01680 (CLI98_00331) | - | 343122..343301 (-) | 180 | WP_022552966.1 | YqzE family protein | - |
| CLI98_RS01685 (CLI98_00332) | comGG | 343358..343735 (-) | 378 | WP_022552965.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| CLI98_RS01690 (CLI98_00333) | comGF | 343736..344131 (-) | 396 | WP_046559876.1 | competence type IV pilus minor pilin ComGF | - |
| CLI98_RS01695 (CLI98_00334) | comGE | 344145..344459 (-) | 315 | WP_021494312.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| CLI98_RS01700 (CLI98_00335) | comGD | 344443..344880 (-) | 438 | WP_007612572.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6642.60 Da Isoelectric Point: 9.8168
>NTDB_id=247038 CLI98_RS01650 WP_014418369.1 339826..339999(+) (sinI) [Bacillus velezensis strain SCGB 574]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=247038 CLI98_RS01650 WP_014418369.1 339826..339999(+) (sinI) [Bacillus velezensis strain SCGB 574]
ATGAAAAATGCAAAAACAGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAACAGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
71.93 |
100 |
0.719 |