Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   CLI98_RS01685 Genome accession   NZ_CP023431
Coordinates   343358..343735 (-) Length   125 a.a.
NCBI ID   WP_022552965.1    Uniprot ID   -
Organism   Bacillus velezensis strain SCGB 574     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 338358..348735
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CLI98_RS01645 (CLI98_00324) - 338855..339649 (+) 795 WP_014418368.1 YqhG family protein -
  CLI98_RS01650 (CLI98_00325) sinI 339826..339999 (+) 174 WP_014418369.1 anti-repressor SinI Regulator
  CLI98_RS01655 (CLI98_00326) sinR 340033..340368 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  CLI98_RS01660 (CLI98_00327) tasA 340416..341201 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  CLI98_RS01665 (CLI98_00328) sipW 341266..341850 (-) 585 WP_022552967.1 signal peptidase I SipW -
  CLI98_RS01670 (CLI98_00329) tapA 341822..342493 (-) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  CLI98_RS01675 (CLI98_00330) - 342752..343081 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  CLI98_RS01680 (CLI98_00331) - 343122..343301 (-) 180 WP_022552966.1 YqzE family protein -
  CLI98_RS01685 (CLI98_00332) comGG 343358..343735 (-) 378 WP_022552965.1 competence type IV pilus minor pilin ComGG Machinery gene
  CLI98_RS01690 (CLI98_00333) comGF 343736..344131 (-) 396 WP_046559876.1 competence type IV pilus minor pilin ComGF -
  CLI98_RS01695 (CLI98_00334) comGE 344145..344459 (-) 315 WP_021494312.1 competence type IV pilus minor pilin ComGE Machinery gene
  CLI98_RS01700 (CLI98_00335) comGD 344443..344880 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  CLI98_RS01705 (CLI98_00336) comGC 344870..345136 (-) 267 WP_050496152.1 competence type IV pilus major pilin ComGC Machinery gene
  CLI98_RS01710 (CLI98_00337) comGB 345183..346220 (-) 1038 WP_022552962.1 competence type IV pilus assembly protein ComGB Machinery gene
  CLI98_RS01715 (CLI98_00338) comGA 346207..347277 (-) 1071 WP_014418378.1 competence type IV pilus ATPase ComGA Machinery gene
  CLI98_RS01720 (CLI98_00339) - 347470..348420 (-) 951 WP_014418379.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14207.16 Da        Isoelectric Point: 9.9338

>NTDB_id=247040 CLI98_RS01685 WP_022552965.1 343358..343735(-) (comGG) [Bacillus velezensis strain SCGB 574]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMTQGQKVQTGTQRFPYGTVS
FHINGSDRRETVQVTIQAETKTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=247040 CLI98_RS01685 WP_022552965.1 343358..343735(-) (comGG) [Bacillus velezensis strain SCGB 574]
ATGTACAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCCGGGGAGTACTGGATCGGAGAGAACCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTACGGCACCGTTTCT
TTTCACATCAACGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCGGAAACCAAGACAGGCACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

50.806

99.2

0.504

Multiple sequence alignment