Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   CMR26_RS04560 Genome accession   NZ_CP023414
Coordinates   870251..870628 (+) Length   125 a.a.
NCBI ID   WP_108724823.1    Uniprot ID   -
Organism   Bacillus velezensis strain BS-37     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 865251..875628
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CMR26_RS04525 (CMR26_04520) - 865567..866517 (+) 951 WP_032870601.1 magnesium transporter CorA family protein -
  CMR26_RS04530 (CMR26_04525) comGA 866709..867779 (+) 1071 WP_012117985.1 competence type IV pilus ATPase ComGA Machinery gene
  CMR26_RS04535 (CMR26_04530) comGB 867766..868803 (+) 1038 WP_032866436.1 competence type IV pilus assembly protein ComGB Machinery gene
  CMR26_RS04540 (CMR26_04535) comGC 868850..869116 (+) 267 WP_042635730.1 competence type IV pilus major pilin ComGC Machinery gene
  CMR26_RS04545 (CMR26_04540) comGD 869106..869543 (+) 438 WP_012117983.1 competence type IV pilus minor pilin ComGD Machinery gene
  CMR26_RS04550 (CMR26_04545) comGE 869527..869841 (+) 315 WP_007408323.1 competence type IV pilus minor pilin ComGE -
  CMR26_RS04555 (CMR26_04550) comGF 869750..870250 (+) 501 WP_258566475.1 competence type IV pilus minor pilin ComGF -
  CMR26_RS04560 (CMR26_04555) comGG 870251..870628 (+) 378 WP_108724823.1 competence type IV pilus minor pilin ComGG Machinery gene
  CMR26_RS04565 (CMR26_04560) - 870685..870864 (+) 180 WP_003153093.1 YqzE family protein -
  CMR26_RS04570 (CMR26_04565) - 870904..871233 (-) 330 WP_012117979.1 DUF3889 domain-containing protein -
  CMR26_RS04575 (CMR26_04570) tapA 871492..872163 (+) 672 WP_085342189.1 amyloid fiber anchoring/assembly protein TapA -
  CMR26_RS04580 (CMR26_04575) sipW 872135..872704 (+) 570 WP_085342188.1 signal peptidase I SipW -
  CMR26_RS04585 (CMR26_04580) tasA 872784..873569 (+) 786 WP_007408329.1 biofilm matrix protein TasA -
  CMR26_RS04590 (CMR26_04585) sinR 873617..873952 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  CMR26_RS04595 (CMR26_04590) sinI 873986..874159 (-) 174 WP_003153105.1 anti-repressor SinI Regulator
  CMR26_RS04600 (CMR26_04595) - 874336..875130 (-) 795 WP_007612541.1 YqhG family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14155.04 Da        Isoelectric Point: 9.7165

>NTDB_id=246872 CMR26_RS04560 WP_108724823.1 870251..870628(+) (comGG) [Bacillus velezensis strain BS-37]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWTGENLLQNGALLSSRHMTQGQKVQTGTQRFPYGTVS
FHITGSDRRETVQVTIQAETTTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=246872 CMR26_RS04560 WP_108724823.1 870251..870628(+) (comGG) [Bacillus velezensis strain BS-37]
ATGTACAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCCGGGGAGTACTGGACCGGAGAGAACCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTATGGCACCGTTTCT
TTTCACATCACGGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCGGAAACAACGACAGGAACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

50

99.2

0.496

Multiple sequence alignment