Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | CMR26_RS04595 | Genome accession | NZ_CP023414 |
| Coordinates | 873986..874159 (-) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain BS-37 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 868986..879159
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CMR26_RS04545 (CMR26_04540) | comGD | 869106..869543 (+) | 438 | WP_012117983.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| CMR26_RS04550 (CMR26_04545) | comGE | 869527..869841 (+) | 315 | WP_007408323.1 | competence type IV pilus minor pilin ComGE | - |
| CMR26_RS04555 (CMR26_04550) | comGF | 869750..870250 (+) | 501 | WP_258566475.1 | competence type IV pilus minor pilin ComGF | - |
| CMR26_RS04560 (CMR26_04555) | comGG | 870251..870628 (+) | 378 | WP_108724823.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| CMR26_RS04565 (CMR26_04560) | - | 870685..870864 (+) | 180 | WP_003153093.1 | YqzE family protein | - |
| CMR26_RS04570 (CMR26_04565) | - | 870904..871233 (-) | 330 | WP_012117979.1 | DUF3889 domain-containing protein | - |
| CMR26_RS04575 (CMR26_04570) | tapA | 871492..872163 (+) | 672 | WP_085342189.1 | amyloid fiber anchoring/assembly protein TapA | - |
| CMR26_RS04580 (CMR26_04575) | sipW | 872135..872704 (+) | 570 | WP_085342188.1 | signal peptidase I SipW | - |
| CMR26_RS04585 (CMR26_04580) | tasA | 872784..873569 (+) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| CMR26_RS04590 (CMR26_04585) | sinR | 873617..873952 (-) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| CMR26_RS04595 (CMR26_04590) | sinI | 873986..874159 (-) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| CMR26_RS04600 (CMR26_04595) | - | 874336..875130 (-) | 795 | WP_007612541.1 | YqhG family protein | - |
| CMR26_RS04605 (CMR26_04600) | - | 875152..876822 (-) | 1671 | WP_031378948.1 | DEAD/DEAH box helicase | - |
| CMR26_RS04610 (CMR26_04605) | gcvT | 877246..878346 (+) | 1101 | WP_032866432.1 | glycine cleavage system aminomethyltransferase GcvT | - |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=246874 CMR26_RS04595 WP_003153105.1 873986..874159(-) (sinI) [Bacillus velezensis strain BS-37]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=246874 CMR26_RS04595 WP_003153105.1 873986..874159(-) (sinI) [Bacillus velezensis strain BS-37]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |