Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   Bateq7PJ16_RS13795 Genome accession   NZ_CP023409
Coordinates   2552492..2552866 (-) Length   124 a.a.
NCBI ID   WP_064671036.1    Uniprot ID   -
Organism   Bacillus subtilis strain 7PJ-16     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2547492..2557866
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  Bateq7PJ16_RS13755 (Bateq7PJ16_2727) yqhG 2547824..2548618 (+) 795 WP_032726154.1 YqhG family protein -
  Bateq7PJ16_RS13760 (Bateq7PJ16_2728) sinI 2548802..2548975 (+) 174 WP_014477323.1 anti-repressor SinI Regulator
  Bateq7PJ16_RS13765 (Bateq7PJ16_2729) sinR 2549009..2549344 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  Bateq7PJ16_RS13770 (Bateq7PJ16_2730) tasA 2549436..2550221 (-) 786 WP_014477324.1 biofilm matrix protein TasA -
  Bateq7PJ16_RS13775 (Bateq7PJ16_2731) sipW 2550286..2550858 (-) 573 WP_003246088.1 signal peptidase I SipW -
  Bateq7PJ16_RS13780 (Bateq7PJ16_2732) tapA 2550842..2551603 (-) 762 WP_064671037.1 amyloid fiber anchoring/assembly protein TapA -
  Bateq7PJ16_RS13785 (Bateq7PJ16_2733) yqzG 2551873..2552199 (+) 327 WP_021480018.1 YqzG/YhdC family protein -
  Bateq7PJ16_RS13790 (Bateq7PJ16_2734) spoIITA 2552241..2552420 (-) 180 WP_014480252.1 YqzE family protein -
  Bateq7PJ16_RS13795 (Bateq7PJ16_2735) comGG 2552492..2552866 (-) 375 WP_064671036.1 ComG operon protein ComGG Machinery gene
  Bateq7PJ16_RS13800 (Bateq7PJ16_2736) comGF 2552867..2553250 (-) 384 WP_032726158.1 ComG operon protein ComGF Machinery gene
  Bateq7PJ16_RS13805 (Bateq7PJ16_2737) comGE 2553276..2553623 (-) 348 WP_063335293.1 ComG operon protein 5 Machinery gene
  Bateq7PJ16_RS13810 (Bateq7PJ16_2738) comGD 2553607..2554038 (-) 432 WP_032726159.1 competence type IV pilus minor pilin ComGD Machinery gene
  Bateq7PJ16_RS13815 (Bateq7PJ16_2739) comGC 2554028..2554324 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  Bateq7PJ16_RS13820 (Bateq7PJ16_2740) comGB 2554338..2555375 (-) 1038 WP_086344083.1 comG operon protein ComGB Machinery gene
  Bateq7PJ16_RS13825 (Bateq7PJ16_2741) comGA 2555362..2556432 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  Bateq7PJ16_RS13830 (Bateq7PJ16_2743) corA 2556836..2557789 (-) 954 WP_015483432.1 magnesium transporter CorA -

Sequence

Protein


Download         Length: 124 a.a.        Molecular weight: 14538.80 Da        Isoelectric Point: 9.7778

>NTDB_id=246796 Bateq7PJ16_RS13795 WP_064671036.1 2552492..2552866(-) (comGG) [Bacillus subtilis strain 7PJ-16]
MYRTRGFIYPAVLFVSALVLLIVNFAAVQYISRCMFEKETKELYIGENLLQNGTLLSIRHVLEERKGQKGTQQFPYGRVS
YYIHDTSIKEQKEINLRVSTESGTERTAQIVFDQKQKKLLRWTE

Nucleotide


Download         Length: 375 bp        

>NTDB_id=246796 Bateq7PJ16_RS13795 WP_064671036.1 2552492..2552866(-) (comGG) [Bacillus subtilis strain 7PJ-16]
ATGTATCGTACAAGAGGGTTTATTTATCCAGCTGTTCTTTTTGTGTCAGCGCTTGTGCTGTTAATCGTGAACTTTGCTGC
TGTTCAATATATTTCACGCTGCATGTTTGAGAAGGAAACAAAAGAGTTATACATAGGAGAGAATTTGCTTCAAAATGGTA
CGCTTCTTTCGATTCGGCATGTTCTAGAGGAACGGAAAGGCCAGAAGGGTACGCAGCAATTTCCATATGGACGGGTTTCT
TATTACATTCATGATACATCGATAAAAGAGCAAAAAGAAATCAACTTAAGAGTGTCAACGGAGTCGGGAACAGAAAGAAC
TGCACAGATCGTGTTTGATCAAAAACAGAAAAAACTGCTGAGATGGACAGAATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

95.161

100

0.952

Multiple sequence alignment