Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   Bateq7PJ16_RS13760 Genome accession   NZ_CP023409
Coordinates   2548802..2548975 (+) Length   57 a.a.
NCBI ID   WP_014477323.1    Uniprot ID   -
Organism   Bacillus subtilis strain 7PJ-16     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2543802..2553975
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  Bateq7PJ16_RS13745 (Bateq7PJ16_2725) gcvT 2544600..2545688 (-) 1089 WP_038829737.1 glycine cleavage system aminomethyltransferase GcvT -
  Bateq7PJ16_RS13750 (Bateq7PJ16_2726) hepAA 2546130..2547803 (+) 1674 WP_038829735.1 SNF2-related protein -
  Bateq7PJ16_RS13755 (Bateq7PJ16_2727) yqhG 2547824..2548618 (+) 795 WP_032726154.1 YqhG family protein -
  Bateq7PJ16_RS13760 (Bateq7PJ16_2728) sinI 2548802..2548975 (+) 174 WP_014477323.1 anti-repressor SinI Regulator
  Bateq7PJ16_RS13765 (Bateq7PJ16_2729) sinR 2549009..2549344 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  Bateq7PJ16_RS13770 (Bateq7PJ16_2730) tasA 2549436..2550221 (-) 786 WP_014477324.1 biofilm matrix protein TasA -
  Bateq7PJ16_RS13775 (Bateq7PJ16_2731) sipW 2550286..2550858 (-) 573 WP_003246088.1 signal peptidase I SipW -
  Bateq7PJ16_RS13780 (Bateq7PJ16_2732) tapA 2550842..2551603 (-) 762 WP_064671037.1 amyloid fiber anchoring/assembly protein TapA -
  Bateq7PJ16_RS13785 (Bateq7PJ16_2733) yqzG 2551873..2552199 (+) 327 WP_021480018.1 YqzG/YhdC family protein -
  Bateq7PJ16_RS13790 (Bateq7PJ16_2734) spoIITA 2552241..2552420 (-) 180 WP_014480252.1 YqzE family protein -
  Bateq7PJ16_RS13795 (Bateq7PJ16_2735) comGG 2552492..2552866 (-) 375 WP_064671036.1 ComG operon protein ComGG Machinery gene
  Bateq7PJ16_RS13800 (Bateq7PJ16_2736) comGF 2552867..2553250 (-) 384 WP_032726158.1 ComG operon protein ComGF Machinery gene
  Bateq7PJ16_RS13805 (Bateq7PJ16_2737) comGE 2553276..2553623 (-) 348 WP_063335293.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6633.58 Da        Isoelectric Point: 6.7231

>NTDB_id=246794 Bateq7PJ16_RS13760 WP_014477323.1 2548802..2548975(+) (sinI) [Bacillus subtilis strain 7PJ-16]
MKNAKQEHFELDQEWVELMMEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=246794 Bateq7PJ16_RS13760 WP_014477323.1 2548802..2548975(+) (sinI) [Bacillus subtilis strain 7PJ-16]
ATGAAAAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTGATGATGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

98.246

100

0.982


Multiple sequence alignment