Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   CMV18_RS08845 Genome accession   NZ_CP023341
Coordinates   1659756..1660133 (+) Length   125 a.a.
NCBI ID   WP_032874019.1    Uniprot ID   -
Organism   Bacillus velezensis strain LG37     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 1654756..1665133
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CMV18_RS08810 (CMV18_08785) - 1655067..1656017 (+) 951 WP_032874012.1 magnesium transporter CorA family protein -
  CMV18_RS08815 (CMV18_08790) comGA 1656214..1657284 (+) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  CMV18_RS08820 (CMV18_08795) comGB 1657271..1658308 (+) 1038 WP_032874014.1 competence type IV pilus assembly protein ComGB Machinery gene
  CMV18_RS08825 (CMV18_08800) comGC 1658313..1658621 (+) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  CMV18_RS08830 (CMV18_08805) comGD 1658611..1659048 (+) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  CMV18_RS08835 (CMV18_08810) comGE 1659032..1659346 (+) 315 WP_032874016.1 competence type IV pilus minor pilin ComGE Machinery gene
  CMV18_RS08840 (CMV18_08815) comGF 1659255..1659755 (+) 501 WP_223204419.1 competence type IV pilus minor pilin ComGF -
  CMV18_RS08845 (CMV18_08820) comGG 1659756..1660133 (+) 378 WP_032874019.1 competence type IV pilus minor pilin ComGG Machinery gene
  CMV18_RS08850 (CMV18_08825) - 1660190..1660369 (+) 180 WP_022552966.1 YqzE family protein -
  CMV18_RS08855 (CMV18_08830) - 1660410..1660739 (-) 330 WP_032874021.1 DUF3889 domain-containing protein -
  CMV18_RS08860 (CMV18_08835) tapA 1660998..1661669 (+) 672 WP_032874023.1 amyloid fiber anchoring/assembly protein TapA -
  CMV18_RS08865 (CMV18_08840) sipW 1661641..1662225 (+) 585 WP_032874025.1 signal peptidase I SipW -
  CMV18_RS08870 (CMV18_08845) tasA 1662290..1663075 (+) 786 WP_032874027.1 biofilm matrix protein TasA -
  CMV18_RS08875 (CMV18_08850) sinR 1663123..1663458 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  CMV18_RS08880 (CMV18_08855) sinI 1663492..1663665 (-) 174 WP_032874029.1 anti-repressor SinI Regulator
  CMV18_RS08885 (CMV18_08860) - 1663842..1664636 (-) 795 WP_007612541.1 YqhG family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14077.01 Da        Isoelectric Point: 10.2236

>NTDB_id=246158 CMV18_RS08845 WP_032874019.1 1659756..1660133(+) (comGG) [Bacillus velezensis strain LG37]
MSKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMAQGKKARTGTQRFPYGTVS
FHISGSDRRETVQVTIQTETTTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=246158 CMV18_RS08845 WP_032874019.1 1659756..1660133(+) (comGG) [Bacillus velezensis strain LG37]
ATGTCCAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCAGGGGAGTACTGGATCGGAGAGAACCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGGCACAGGGAAAAAAGGCCCGAACTGGTACACAGCGTTTTCCGTATGGCACCGTTTCT
TTTCACATCTCCGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGACGGAAACCACGACAGGTACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

49.194

99.2

0.488

Multiple sequence alignment