Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGD   Type   Machinery gene
Locus tag   CMV18_RS08830 Genome accession   NZ_CP023341
Coordinates   1658611..1659048 (+) Length   145 a.a.
NCBI ID   WP_007612572.1    Uniprot ID   -
Organism   Bacillus velezensis strain LG37     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 1653611..1664048
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CMV18_RS08805 (CMV18_08780) - 1653620..1654921 (-) 1302 WP_032874010.1 hemolysin family protein -
  CMV18_RS08810 (CMV18_08785) - 1655067..1656017 (+) 951 WP_032874012.1 magnesium transporter CorA family protein -
  CMV18_RS08815 (CMV18_08790) comGA 1656214..1657284 (+) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  CMV18_RS08820 (CMV18_08795) comGB 1657271..1658308 (+) 1038 WP_032874014.1 competence type IV pilus assembly protein ComGB Machinery gene
  CMV18_RS08825 (CMV18_08800) comGC 1658313..1658621 (+) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  CMV18_RS08830 (CMV18_08805) comGD 1658611..1659048 (+) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  CMV18_RS08835 (CMV18_08810) comGE 1659032..1659346 (+) 315 WP_032874016.1 competence type IV pilus minor pilin ComGE Machinery gene
  CMV18_RS08840 (CMV18_08815) comGF 1659255..1659755 (+) 501 WP_223204419.1 competence type IV pilus minor pilin ComGF -
  CMV18_RS08845 (CMV18_08820) comGG 1659756..1660133 (+) 378 WP_032874019.1 competence type IV pilus minor pilin ComGG Machinery gene
  CMV18_RS08850 (CMV18_08825) - 1660190..1660369 (+) 180 WP_022552966.1 YqzE family protein -
  CMV18_RS08855 (CMV18_08830) - 1660410..1660739 (-) 330 WP_032874021.1 DUF3889 domain-containing protein -
  CMV18_RS08860 (CMV18_08835) tapA 1660998..1661669 (+) 672 WP_032874023.1 amyloid fiber anchoring/assembly protein TapA -
  CMV18_RS08865 (CMV18_08840) sipW 1661641..1662225 (+) 585 WP_032874025.1 signal peptidase I SipW -
  CMV18_RS08870 (CMV18_08845) tasA 1662290..1663075 (+) 786 WP_032874027.1 biofilm matrix protein TasA -
  CMV18_RS08875 (CMV18_08850) sinR 1663123..1663458 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  CMV18_RS08880 (CMV18_08855) sinI 1663492..1663665 (-) 174 WP_032874029.1 anti-repressor SinI Regulator

Sequence


Protein


Download         Length: 145 a.a.        Molecular weight: 16254.76 Da        Isoelectric Point: 10.1850

>NTDB_id=246156 CMV18_RS08830 WP_007612572.1 1658611..1659048(+) (comGD) [Bacillus velezensis strain LG37]
MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPVCTHLAVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPKEHKYK
LQSGGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIQLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide


Download         Length: 438 bp        

>NTDB_id=246156 CMV18_RS08830 WP_007612572.1 1658611..1659048(+) (comGD) [Bacillus velezensis strain LG37]
TTGAACAATAACAGGCGGACAGAAAATGGGTTTACCCTTCTTGAAAGCCTGATTGTGTTAAGCCTGGCGTCCGTCCTGCT
GACGGTTTTGTTCACGACGGTTCCGCCGGTCTGCACCCACCTTGCCGTGCGGCAAAAAACAGAACAGCTCCAAAAAGATA
TTCAGCTTGCTCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAAAGAGCATAAATACAAA
CTGCAGTCAGGCGGAAGGATTGTCGAGCGTTCTTTTGATTCGCTTCATATTACACTTGTAACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATTCAATTGAAGAGCGCCGGGTTCACCTATGAGATAACAGTTT
ACTTAGGGAGCGGAAATGTCCATGCTAAACGGAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Bacillus subtilis subsp. subtilis str. 168

55.479

100

0.559


Multiple sequence alignment