Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   CMV18_RS08880 Genome accession   NZ_CP023341
Coordinates   1663492..1663665 (-) Length   57 a.a.
NCBI ID   WP_032874029.1    Uniprot ID   -
Organism   Bacillus velezensis strain LG37     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 1658492..1668665
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CMV18_RS08830 (CMV18_08805) comGD 1658611..1659048 (+) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  CMV18_RS08835 (CMV18_08810) comGE 1659032..1659346 (+) 315 WP_032874016.1 competence type IV pilus minor pilin ComGE Machinery gene
  CMV18_RS08840 (CMV18_08815) comGF 1659255..1659755 (+) 501 WP_223204419.1 competence type IV pilus minor pilin ComGF -
  CMV18_RS08845 (CMV18_08820) comGG 1659756..1660133 (+) 378 WP_032874019.1 competence type IV pilus minor pilin ComGG Machinery gene
  CMV18_RS08850 (CMV18_08825) - 1660190..1660369 (+) 180 WP_022552966.1 YqzE family protein -
  CMV18_RS08855 (CMV18_08830) - 1660410..1660739 (-) 330 WP_032874021.1 DUF3889 domain-containing protein -
  CMV18_RS08860 (CMV18_08835) tapA 1660998..1661669 (+) 672 WP_032874023.1 amyloid fiber anchoring/assembly protein TapA -
  CMV18_RS08865 (CMV18_08840) sipW 1661641..1662225 (+) 585 WP_032874025.1 signal peptidase I SipW -
  CMV18_RS08870 (CMV18_08845) tasA 1662290..1663075 (+) 786 WP_032874027.1 biofilm matrix protein TasA -
  CMV18_RS08875 (CMV18_08850) sinR 1663123..1663458 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  CMV18_RS08880 (CMV18_08855) sinI 1663492..1663665 (-) 174 WP_032874029.1 anti-repressor SinI Regulator
  CMV18_RS08885 (CMV18_08860) - 1663842..1664636 (-) 795 WP_007612541.1 YqhG family protein -
  CMV18_RS08890 (CMV18_08865) - 1664658..1666328 (-) 1671 WP_032874031.1 DEAD/DEAH box helicase -
  CMV18_RS08895 (CMV18_08870) gcvT 1666751..1667851 (+) 1101 WP_032874033.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6658.66 Da        Isoelectric Point: 9.8168

>NTDB_id=246160 CMV18_RS08880 WP_032874029.1 1663492..1663665(-) (sinI) [Bacillus velezensis strain LG37]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHVQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=246160 CMV18_RS08880 WP_032874029.1 1663492..1663665(-) (sinI) [Bacillus velezensis strain LG37]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATGTCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

71.93

100

0.719

Multiple sequence alignment