Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | CMV18_RS08880 | Genome accession | NZ_CP023341 |
| Coordinates | 1663492..1663665 (-) | Length | 57 a.a. |
| NCBI ID | WP_032874029.1 | Uniprot ID | - |
| Organism | Bacillus velezensis strain LG37 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 1658492..1668665
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CMV18_RS08830 (CMV18_08805) | comGD | 1658611..1659048 (+) | 438 | WP_007612572.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| CMV18_RS08835 (CMV18_08810) | comGE | 1659032..1659346 (+) | 315 | WP_032874016.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| CMV18_RS08840 (CMV18_08815) | comGF | 1659255..1659755 (+) | 501 | WP_223204419.1 | competence type IV pilus minor pilin ComGF | - |
| CMV18_RS08845 (CMV18_08820) | comGG | 1659756..1660133 (+) | 378 | WP_032874019.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| CMV18_RS08850 (CMV18_08825) | - | 1660190..1660369 (+) | 180 | WP_022552966.1 | YqzE family protein | - |
| CMV18_RS08855 (CMV18_08830) | - | 1660410..1660739 (-) | 330 | WP_032874021.1 | DUF3889 domain-containing protein | - |
| CMV18_RS08860 (CMV18_08835) | tapA | 1660998..1661669 (+) | 672 | WP_032874023.1 | amyloid fiber anchoring/assembly protein TapA | - |
| CMV18_RS08865 (CMV18_08840) | sipW | 1661641..1662225 (+) | 585 | WP_032874025.1 | signal peptidase I SipW | - |
| CMV18_RS08870 (CMV18_08845) | tasA | 1662290..1663075 (+) | 786 | WP_032874027.1 | biofilm matrix protein TasA | - |
| CMV18_RS08875 (CMV18_08850) | sinR | 1663123..1663458 (-) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| CMV18_RS08880 (CMV18_08855) | sinI | 1663492..1663665 (-) | 174 | WP_032874029.1 | anti-repressor SinI | Regulator |
| CMV18_RS08885 (CMV18_08860) | - | 1663842..1664636 (-) | 795 | WP_007612541.1 | YqhG family protein | - |
| CMV18_RS08890 (CMV18_08865) | - | 1664658..1666328 (-) | 1671 | WP_032874031.1 | DEAD/DEAH box helicase | - |
| CMV18_RS08895 (CMV18_08870) | gcvT | 1666751..1667851 (+) | 1101 | WP_032874033.1 | glycine cleavage system aminomethyltransferase GcvT | - |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6658.66 Da Isoelectric Point: 9.8168
>NTDB_id=246160 CMV18_RS08880 WP_032874029.1 1663492..1663665(-) (sinI) [Bacillus velezensis strain LG37]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHVQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHVQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=246160 CMV18_RS08880 WP_032874029.1 1663492..1663665(-) (sinI) [Bacillus velezensis strain LG37]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATGTCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATGTCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
71.93 |
100 |
0.719 |