Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   CJZ71_RS03135 Genome accession   NZ_CP022891
Coordinates   541912..542286 (-) Length   124 a.a.
NCBI ID   WP_069837632.1    Uniprot ID   -
Organism   Bacillus subtilis strain DKU_NT_03     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 536912..547286
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CJZ71_RS03095 (CJZ71_03095) yqhG 537244..538038 (+) 795 WP_014480249.1 YqhG family protein -
  CJZ71_RS03100 (CJZ71_03100) sinI 538221..538394 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  CJZ71_RS03105 (CJZ71_03105) sinR 538428..538763 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  CJZ71_RS03110 (CJZ71_03110) tasA 538856..539641 (-) 786 WP_014480250.1 biofilm matrix protein TasA -
  CJZ71_RS03115 (CJZ71_03115) sipW 539705..540277 (-) 573 WP_003230181.1 signal peptidase I SipW -
  CJZ71_RS03120 (CJZ71_03120) tapA 540261..541022 (-) 762 WP_014480251.1 amyloid fiber anchoring/assembly protein TapA -
  CJZ71_RS03125 (CJZ71_03125) yqzG 541294..541620 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  CJZ71_RS03130 (CJZ71_03130) spoIITA 541662..541841 (-) 180 WP_014480252.1 YqzE family protein -
  CJZ71_RS03135 (CJZ71_03135) comGG 541912..542286 (-) 375 WP_069837632.1 ComG operon protein ComGG Machinery gene
  CJZ71_RS03140 (CJZ71_03140) comGF 542287..542670 (-) 384 WP_029317913.1 ComG operon protein ComGF Machinery gene
  CJZ71_RS03145 (CJZ71_03145) comGE 542696..543043 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene
  CJZ71_RS03150 (CJZ71_03150) comGD 543027..543458 (-) 432 WP_014480256.1 comG operon protein ComGD Machinery gene
  CJZ71_RS03155 (CJZ71_03155) comGC 543448..543744 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  CJZ71_RS03160 (CJZ71_03160) comGB 543758..544795 (-) 1038 WP_031600685.1 comG operon protein ComGB Machinery gene
  CJZ71_RS03165 (CJZ71_03165) comGA 544782..545852 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  CJZ71_RS03170 (CJZ71_03170) - 546064..546261 (-) 198 WP_014480259.1 CBS domain-containing protein -
  CJZ71_RS03175 (CJZ71_03175) corA 546263..547216 (-) 954 WP_014480260.1 magnesium transporter CorA -

Sequence

Protein


Download         Length: 124 a.a.        Molecular weight: 14509.72 Da        Isoelectric Point: 9.2806

>NTDB_id=242604 CJZ71_RS03135 WP_069837632.1 541912..542286(-) (comGG) [Bacillus subtilis strain DKU_NT_03]
MYRTRGFIYPAVLFVSALVLLIVNFAAAQYISRCMFEKETKELYIGENLLQNGVLLSLRHVLEERKGQEGTQQFPYGRVS
YYIHDTSIKEQKEINLRVSTESGTERTAQIVFDQKQKKLLRWTE

Nucleotide


Download         Length: 375 bp        

>NTDB_id=242604 CJZ71_RS03135 WP_069837632.1 541912..542286(-) (comGG) [Bacillus subtilis strain DKU_NT_03]
ATGTATCGTACAAGAGGGTTTATTTATCCAGCTGTTCTTTTTGTGTCAGCGCTTGTGCTGTTAATCGTGAACTTTGCTGC
TGCTCAATATATTTCACGCTGCATGTTTGAGAAGGAAACAAAAGAGTTATACATAGGAGAGAATTTGCTTCAAAATGGGG
TGCTTCTTTCGCTTCGGCATGTTCTAGAGGAACGGAAAGGCCAGGAGGGTACGCAGCAATTTCCATATGGACGGGTTTCT
TATTACATTCATGATACATCGATAAAAGAACAAAAAGAAATCAACTTAAGAGTGTCAACGGAGTCGGGAACAGAAAGAAC
TGCACAGATCGTATTTGATCAAAAACAGAAAAAACTGCTGAGATGGACAGAATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

96.774

100

0.968

Multiple sequence alignment