Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   CJZ71_RS03140 Genome accession   NZ_CP022891
Coordinates   542287..542670 (-) Length   127 a.a.
NCBI ID   WP_029317913.1    Uniprot ID   -
Organism   Bacillus subtilis strain DKU_NT_03     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 537287..547670
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CJZ71_RS03100 (CJZ71_03100) sinI 538221..538394 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  CJZ71_RS03105 (CJZ71_03105) sinR 538428..538763 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  CJZ71_RS03110 (CJZ71_03110) tasA 538856..539641 (-) 786 WP_014480250.1 biofilm matrix protein TasA -
  CJZ71_RS03115 (CJZ71_03115) sipW 539705..540277 (-) 573 WP_003230181.1 signal peptidase I SipW -
  CJZ71_RS03120 (CJZ71_03120) tapA 540261..541022 (-) 762 WP_014480251.1 amyloid fiber anchoring/assembly protein TapA -
  CJZ71_RS03125 (CJZ71_03125) yqzG 541294..541620 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  CJZ71_RS03130 (CJZ71_03130) spoIITA 541662..541841 (-) 180 WP_014480252.1 YqzE family protein -
  CJZ71_RS03135 (CJZ71_03135) comGG 541912..542286 (-) 375 WP_069837632.1 ComG operon protein ComGG Machinery gene
  CJZ71_RS03140 (CJZ71_03140) comGF 542287..542670 (-) 384 WP_029317913.1 ComG operon protein ComGF Machinery gene
  CJZ71_RS03145 (CJZ71_03145) comGE 542696..543043 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene
  CJZ71_RS03150 (CJZ71_03150) comGD 543027..543458 (-) 432 WP_014480256.1 comG operon protein ComGD Machinery gene
  CJZ71_RS03155 (CJZ71_03155) comGC 543448..543744 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  CJZ71_RS03160 (CJZ71_03160) comGB 543758..544795 (-) 1038 WP_031600685.1 comG operon protein ComGB Machinery gene
  CJZ71_RS03165 (CJZ71_03165) comGA 544782..545852 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  CJZ71_RS03170 (CJZ71_03170) - 546064..546261 (-) 198 WP_014480259.1 CBS domain-containing protein -
  CJZ71_RS03175 (CJZ71_03175) corA 546263..547216 (-) 954 WP_014480260.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14363.43 Da        Isoelectric Point: 5.8949

>NTDB_id=242605 CJZ71_RS03140 WP_029317913.1 542287..542670(-) (comGF) [Bacillus subtilis strain DKU_NT_03]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFEIYHSMIRKRVDG
KGHVPILDHITAMKADFENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=242605 CJZ71_RS03140 WP_029317913.1 542287..542670(-) (comGF) [Bacillus subtilis strain DKU_NT_03]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGGCAGGACATCCGTTTCGAAATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATTTTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

97.638

100

0.976


Multiple sequence alignment