Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   BaGK_RS16705 Genome accession   NZ_CP022653
Coordinates   3370311..3370454 (-) Length   47 a.a.
NCBI ID   WP_003327149.1    Uniprot ID   -
Organism   Bacillus atrophaeus strain GQJK17     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3365311..3375454
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BaGK_RS16680 (BaGK_16680) - 3365634..3366014 (-) 381 WP_010789785.1 hotdog fold thioesterase -
  BaGK_RS16685 (BaGK_16685) comA 3366032..3366673 (-) 642 WP_094232700.1 response regulator transcription factor Regulator
  BaGK_RS16690 (BaGK_16690) comP 3366754..3369060 (-) 2307 WP_094232701.1 two-component system sensor histidine kinase ComP Regulator
  BaGK_RS16695 (BaGK_16695) comX 3369074..3369241 (-) 168 WP_094232702.1 competence pheromone ComX Regulator
  BaGK_RS16700 (BaGK_16700) comQ 3369225..3370127 (-) 903 WP_094233215.1 polyprenyl synthetase family protein Regulator
  BaGK_RS16705 (BaGK_16705) degQ 3370311..3370454 (-) 144 WP_003327149.1 degradation enzyme regulation protein DegQ Regulator
  BaGK_RS16710 (BaGK_16710) - 3370913..3371272 (+) 360 WP_094232703.1 hypothetical protein -
  BaGK_RS16715 (BaGK_16715) - 3371291..3372523 (-) 1233 WP_003327147.1 EAL and HDOD domain-containing protein -
  BaGK_RS16720 (BaGK_16720) - 3372661..3374127 (-) 1467 WP_088117879.1 nicotinate phosphoribosyltransferase -
  BaGK_RS16725 (BaGK_16725) - 3374143..3374694 (-) 552 WP_003327145.1 cysteine hydrolase family protein -
  BaGK_RS16730 (BaGK_16730) - 3374802..3375200 (-) 399 WP_003327144.1 YueI family protein -

Sequence

Protein


Download         Length: 47 a.a.        Molecular weight: 5645.61 Da        Isoelectric Point: 8.5787

>NTDB_id=241264 BaGK_RS16705 WP_003327149.1 3370311..3370454(-) (degQ) [Bacillus atrophaeus strain GQJK17]
MEKKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKFTYAMKIS

Nucleotide


Download         Length: 144 bp        

>NTDB_id=241264 BaGK_RS16705 WP_003327149.1 3370311..3370454(-) (degQ) [Bacillus atrophaeus strain GQJK17]
GTGGAAAAGAAAAAACTTGAAGAAGTGAAACAATTATTATTCCGACTCGAACTTGATATCAAAGAAACGACAGATTCATT
ACGAAACATTAACAAAAGCATTGATCAGCTCGATAAATTCACATATGCAATGAAAATTTCGTGA

Domains

Predicted by InterProScan.

DegQ (SacQ) family (DegQ)

(1-47)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

95.455

93.617

0.894

Multiple sequence alignment