Detailed information    

insolico Bioinformatically predicted

Overview

Name   comX   Type   Regulator
Locus tag   BaGK_RS16695 Genome accession   NZ_CP022653
Coordinates   3369074..3369241 (-) Length   55 a.a.
NCBI ID   WP_094232702.1    Uniprot ID   -
Organism   Bacillus atrophaeus strain GQJK17     
Function   binding to ComP; trigger autophosphorylation of ComP (predicted from homology)   
Competence regulation

Genomic Context

Location: 3364074..3374241
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BaGK_RS16665 (BaGK_16665) - 3364477..3364953 (+) 477 WP_094232698.1 Na+/H+ antiporter subunit E -
  BaGK_RS16670 (BaGK_16670) - 3364953..3365237 (+) 285 WP_094232699.1 Na(+)/H(+) antiporter subunit F1 -
  BaGK_RS16675 (BaGK_16675) mnhG 3365221..3365595 (+) 375 WP_061570550.1 monovalent cation/H(+) antiporter subunit G -
  BaGK_RS16680 (BaGK_16680) - 3365634..3366014 (-) 381 WP_010789785.1 hotdog fold thioesterase -
  BaGK_RS16685 (BaGK_16685) comA 3366032..3366673 (-) 642 WP_094232700.1 response regulator transcription factor Regulator
  BaGK_RS16690 (BaGK_16690) comP 3366754..3369060 (-) 2307 WP_094232701.1 two-component system sensor histidine kinase ComP Regulator
  BaGK_RS16695 (BaGK_16695) comX 3369074..3369241 (-) 168 WP_094232702.1 competence pheromone ComX Regulator
  BaGK_RS16700 (BaGK_16700) comQ 3369225..3370127 (-) 903 WP_094233215.1 polyprenyl synthetase family protein Regulator
  BaGK_RS16705 (BaGK_16705) degQ 3370311..3370454 (-) 144 WP_003327149.1 degradation enzyme regulation protein DegQ Regulator
  BaGK_RS16710 (BaGK_16710) - 3370913..3371272 (+) 360 WP_094232703.1 hypothetical protein -
  BaGK_RS16715 (BaGK_16715) - 3371291..3372523 (-) 1233 WP_003327147.1 EAL and HDOD domain-containing protein -
  BaGK_RS16720 (BaGK_16720) - 3372661..3374127 (-) 1467 WP_088117879.1 nicotinate phosphoribosyltransferase -

Sequence

Protein


Download         Length: 55 a.a.        Molecular weight: 6586.47 Da        Isoelectric Point: 4.6094

>NTDB_id=241262 BaGK_RS16695 WP_094232702.1 3369074..3369241(-) (comX) [Bacillus atrophaeus strain GQJK17]
MQDLINYFLNYPEVLKKLKNKEACLIGFDLDETQTILKAYDDYHMSAQRTREWDG

Nucleotide


Download         Length: 168 bp        

>NTDB_id=241262 BaGK_RS16695 WP_094232702.1 3369074..3369241(-) (comX) [Bacillus atrophaeus strain GQJK17]
ATGCAAGATCTAATTAATTACTTTTTAAATTATCCTGAAGTATTAAAAAAATTGAAAAATAAAGAAGCTTGCCTTATAGG
TTTTGATTTAGACGAAACTCAAACAATACTTAAAGCTTACGATGATTATCATATGTCTGCTCAAAGAACTCGTGAATGGG
ACGGTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comX Bacillus subtilis subsp. subtilis str. 168

75.472

96.364

0.727

Multiple sequence alignment