Detailed information
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | CG450_RS18925 | Genome accession | NZ_CP022477 |
| Coordinates | 3585337..3585828 (-) | Length | 163 a.a. |
| NCBI ID | WP_094023937.1 | Uniprot ID | - |
| Organism | Bacillus licheniformis strain BL-010 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 3560359..3593328 | 3585337..3585828 | within | 0 |
Gene organization within MGE regions
Location: 3560359..3593328
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CG450_RS18775 | - | 3560359..3562053 (-) | 1695 | WP_094023908.1 | LysM peptidoglycan-binding domain-containing protein | - |
| CG450_RS18780 | - | 3562057..3562311 (-) | 255 | WP_157675220.1 | phage holin | - |
| CG450_RS18785 | - | 3562317..3562694 (-) | 378 | WP_094023910.1 | hypothetical protein | - |
| CG450_RS22585 | - | 3562850..3563035 (+) | 186 | WP_146842142.1 | hypothetical protein | - |
| CG450_RS22590 | - | 3563111..3563254 (-) | 144 | WP_157675222.1 | hypothetical protein | - |
| CG450_RS22595 | - | 3563268..3563408 (-) | 141 | WP_157675224.1 | hypothetical protein | - |
| CG450_RS18795 | - | 3563401..3563730 (-) | 330 | WP_094023912.1 | hypothetical protein | - |
| CG450_RS18800 | - | 3563730..3565661 (-) | 1932 | WP_094023913.1 | DUF859 family phage minor structural protein | - |
| CG450_RS22600 | - | 3565675..3568686 (-) | 3012 | WP_198318204.1 | phage tail spike protein | - |
| CG450_RS18810 | - | 3568686..3569336 (-) | 651 | WP_094023914.1 | hypothetical protein | - |
| CG450_RS18815 | - | 3569336..3572590 (-) | 3255 | WP_094023915.1 | hypothetical protein | - |
| CG450_RS18820 | - | 3572592..3572840 (-) | 249 | WP_146842145.1 | peptide methionine sulfoxide reductase | - |
| CG450_RS18825 | - | 3572906..3573319 (-) | 414 | WP_094023917.1 | hypothetical protein | - |
| CG450_RS18830 | - | 3573336..3573962 (-) | 627 | WP_094023918.1 | hypothetical protein | - |
| CG450_RS18840 | - | 3574335..3574766 (-) | 432 | WP_094023920.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| CG450_RS18845 | - | 3574759..3575082 (-) | 324 | WP_198318205.1 | phage head closure protein | - |
| CG450_RS18850 | - | 3575082..3575615 (-) | 534 | WP_094023922.1 | hypothetical protein | - |
| CG450_RS18855 | - | 3575653..3575898 (-) | 246 | WP_094023923.1 | hypothetical protein | - |
| CG450_RS18860 | - | 3575912..3576832 (-) | 921 | WP_094023924.1 | hypothetical protein | - |
| CG450_RS18865 | - | 3576851..3577423 (-) | 573 | WP_157675226.1 | phage scaffolding protein | - |
| CG450_RS18870 | - | 3577632..3577811 (-) | 180 | WP_094023926.1 | hypothetical protein | - |
| CG450_RS22605 | - | 3577868..3578032 (-) | 165 | WP_157675228.1 | hypothetical protein | - |
| CG450_RS18875 | - | 3578039..3579730 (-) | 1692 | WP_094023927.1 | phage minor head protein | - |
| CG450_RS18880 | - | 3579705..3581189 (-) | 1485 | WP_094023928.1 | phage portal protein | - |
| CG450_RS18885 | - | 3581202..3582413 (-) | 1212 | WP_094023929.1 | PBSX family phage terminase large subunit | - |
| CG450_RS18890 | - | 3582400..3583233 (-) | 834 | WP_094023930.1 | terminase small subunit | - |
| CG450_RS18895 | - | 3583381..3583803 (-) | 423 | WP_094023931.1 | hypothetical protein | - |
| CG450_RS18900 | - | 3583816..3584019 (-) | 204 | WP_146842146.1 | hypothetical protein | - |
| CG450_RS18905 | - | 3584031..3584456 (-) | 426 | WP_094023933.1 | helix-turn-helix domain-containing protein | - |
| CG450_RS22610 | - | 3584484..3584654 (-) | 171 | WP_157675230.1 | hypothetical protein | - |
| CG450_RS18910 | - | 3584666..3584866 (-) | 201 | WP_094023934.1 | hypothetical protein | - |
| CG450_RS18915 | - | 3584863..3585108 (-) | 246 | WP_094023935.1 | hypothetical protein | - |
| CG450_RS18920 | - | 3585105..3585323 (-) | 219 | WP_094023936.1 | hypothetical protein | - |
| CG450_RS18925 | ssbA | 3585337..3585828 (-) | 492 | WP_094023937.1 | single-stranded DNA-binding protein | Machinery gene |
| CG450_RS18930 | - | 3585851..3586156 (-) | 306 | WP_094023938.1 | hypothetical protein | - |
| CG450_RS18935 | - | 3586210..3587043 (-) | 834 | WP_094023939.1 | ATP-binding protein | - |
| CG450_RS18940 | - | 3587012..3587788 (-) | 777 | WP_094023940.1 | helix-turn-helix domain-containing protein | - |
| CG450_RS23235 | - | 3587915..3588049 (-) | 135 | WP_261795708.1 | hypothetical protein | - |
| CG450_RS18945 | - | 3588162..3588824 (-) | 663 | WP_094023941.1 | putative HNHc nuclease | - |
| CG450_RS18950 | - | 3588837..3589775 (-) | 939 | WP_232513262.1 | DUF1351 domain-containing protein | - |
| CG450_RS18955 | - | 3589790..3590566 (-) | 777 | WP_094023943.1 | ERF family protein | - |
| CG450_RS22615 | - | 3590665..3590808 (-) | 144 | WP_157675234.1 | hypothetical protein | - |
| CG450_RS18960 | - | 3590879..3591058 (-) | 180 | WP_094023944.1 | transcriptional regulator | - |
| CG450_RS18965 | - | 3591095..3591298 (-) | 204 | WP_094023945.1 | helix-turn-helix transcriptional regulator | - |
| CG450_RS18970 | - | 3591460..3592077 (+) | 618 | WP_094023946.1 | LexA family transcriptional regulator | - |
| CG450_RS18975 | - | 3592204..3593328 (+) | 1125 | WP_094023947.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 163 a.a. Molecular weight: 17958.51 Da Isoelectric Point: 5.1959
>NTDB_id=239918 CG450_RS18925 WP_094023937.1 3585337..3585828(-) (ssbA) [Bacillus licheniformis strain BL-010]
MINNVVLVGRLTADIDLRYTQTGTAVGNFNLAVNRTFTNQNGEREADYIRCVAWRKTAETAANFVGKGSLVGIQGRIQTR
HYDNEQGQRIYITEVVAESIQYLDSRNKSNNGGQSYGQGNSQGNYQNSTGGNFGGNQGGFGQHRDPFERTADPIEISDDD
LPF
MINNVVLVGRLTADIDLRYTQTGTAVGNFNLAVNRTFTNQNGEREADYIRCVAWRKTAETAANFVGKGSLVGIQGRIQTR
HYDNEQGQRIYITEVVAESIQYLDSRNKSNNGGQSYGQGNSQGNYQNSTGGNFGGNQGGFGQHRDPFERTADPIEISDDD
LPF
Nucleotide
Download Length: 492 bp
>NTDB_id=239918 CG450_RS18925 WP_094023937.1 3585337..3585828(-) (ssbA) [Bacillus licheniformis strain BL-010]
ATGATCAATAACGTGGTGCTGGTTGGCCGGTTAACCGCCGACATCGACCTTAGATACACGCAAACAGGAACGGCAGTGGG
AAACTTTAACCTGGCAGTAAACCGCACATTTACCAATCAAAACGGCGAACGTGAGGCGGATTATATCCGCTGCGTTGCCT
GGAGAAAGACGGCAGAAACGGCAGCAAACTTCGTCGGCAAAGGCTCCTTGGTAGGCATTCAAGGACGCATCCAGACAAGA
CACTATGACAACGAGCAAGGGCAGCGCATTTATATCACGGAAGTTGTAGCTGAATCCATCCAGTACTTAGATAGCCGAAA
CAAGTCGAATAACGGCGGTCAAAGTTACGGACAGGGAAACAGTCAAGGAAACTATCAAAATAGCACAGGCGGAAATTTTG
GAGGCAATCAGGGCGGATTTGGCCAACACAGGGACCCGTTTGAACGGACAGCTGATCCAATTGAAATTTCTGATGATGAT
TTGCCTTTCTGA
ATGATCAATAACGTGGTGCTGGTTGGCCGGTTAACCGCCGACATCGACCTTAGATACACGCAAACAGGAACGGCAGTGGG
AAACTTTAACCTGGCAGTAAACCGCACATTTACCAATCAAAACGGCGAACGTGAGGCGGATTATATCCGCTGCGTTGCCT
GGAGAAAGACGGCAGAAACGGCAGCAAACTTCGTCGGCAAAGGCTCCTTGGTAGGCATTCAAGGACGCATCCAGACAAGA
CACTATGACAACGAGCAAGGGCAGCGCATTTATATCACGGAAGTTGTAGCTGAATCCATCCAGTACTTAGATAGCCGAAA
CAAGTCGAATAACGGCGGTCAAAGTTACGGACAGGGAAACAGTCAAGGAAACTATCAAAATAGCACAGGCGGAAATTTTG
GAGGCAATCAGGGCGGATTTGGCCAACACAGGGACCCGTTTGAACGGACAGCTGATCCAATTGAAATTTCTGATGATGAT
TTGCCTTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
56.395 |
100 |
0.595 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
54.545 |
100 |
0.589 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
56.481 |
66.258 |
0.374 |
| ssb | Neisseria meningitidis MC58 |
34.483 |
100 |
0.368 |
| ssb | Neisseria gonorrhoeae MS11 |
34.483 |
100 |
0.368 |