Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   CGC32_RS00720 Genome accession   NZ_CP022409
Coordinates   150614..150727 (+) Length   37 a.a.
NCBI ID   WP_001217873.1    Uniprot ID   G2MCV1
Organism   Helicobacter pylori strain G272     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 145614..155727
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CGC32_RS00695 (CGC32_00695) - 145674..147896 (+) 2223 WP_089482205.1 AAA family ATPase -
  CGC32_RS00700 (CGC32_00700) panD 147886..148236 (+) 351 WP_000142213.1 aspartate 1-decarboxylase -
  CGC32_RS00705 (CGC32_00705) - 148247..148540 (+) 294 WP_000347916.1 YbaB/EbfC family nucleoid-associated protein -
  CGC32_RS00710 (CGC32_00710) - 148540..149535 (+) 996 WP_089482206.1 PDZ domain-containing protein -
  CGC32_RS00715 (CGC32_00715) comB6 149543..150598 (+) 1056 WP_089482207.1 P-type conjugative transfer protein TrbL Machinery gene
  CGC32_RS00720 (CGC32_00720) comB7 150614..150727 (+) 114 WP_001217873.1 hypothetical protein Machinery gene
  CGC32_RS00725 (CGC32_00725) comB8 150724..151467 (+) 744 WP_089482208.1 type IV secretion system protein Machinery gene
  CGC32_RS00730 (CGC32_00730) comB9 151467..152429 (+) 963 WP_089482209.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  CGC32_RS00735 (CGC32_00735) comB10 152422..153558 (+) 1137 WP_089482210.1 DNA type IV secretion system protein ComB10 Machinery gene
  CGC32_RS00740 (CGC32_00740) - 153627..155039 (+) 1413 WP_089482211.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 37 a.a.        Molecular weight: 4325.25 Da        Isoelectric Point: 9.3572

>NTDB_id=239203 CGC32_RS00720 WP_001217873.1 150614..150727(+) (comB7) [Helicobacter pylori strain G272]
MRIFFVIMGLVFFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=239203 CGC32_RS00720 WP_001217873.1 150614..150727(+) (comB7) [Helicobacter pylori strain G272]
ATGAGAATTTTTTTTGTTATTATGGGACTTGTGTTTTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACCTTGTATGAAAATAGGTTAAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G2MCV1

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

100

100

1


Multiple sequence alignment