Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   CDO84_RS11365 Genome accession   NZ_CP021911
Coordinates   2284437..2284811 (-) Length   124 a.a.
NCBI ID   WP_040082643.1    Uniprot ID   -
Organism   Bacillus sp. MD-5     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2279437..2289811
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CDO84_RS11325 (CDO84_11325) - 2279773..2280567 (+) 795 WP_014664585.1 YqhG family protein -
  CDO84_RS11330 (CDO84_11330) sinI 2280751..2280924 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  CDO84_RS11335 (CDO84_11335) sinR 2280958..2281293 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  CDO84_RS11340 (CDO84_11340) tasA 2281387..2282172 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  CDO84_RS11345 (CDO84_11345) - 2282236..2282808 (-) 573 WP_014664587.1 signal peptidase I -
  CDO84_RS11350 (CDO84_11350) tapA 2282792..2283547 (-) 756 WP_014664588.1 amyloid fiber anchoring/assembly protein TapA -
  CDO84_RS11355 (CDO84_11355) - 2283819..2284145 (+) 327 WP_040082645.1 YqzG/YhdC family protein -
  CDO84_RS11360 (CDO84_11360) - 2284186..2284365 (-) 180 WP_014480252.1 YqzE family protein -
  CDO84_RS11365 (CDO84_11365) comGG 2284437..2284811 (-) 375 WP_040082643.1 competence type IV pilus minor pilin ComGG Machinery gene
  CDO84_RS11370 (CDO84_11370) comGF 2284812..2285192 (-) 381 WP_040082642.1 competence type IV pilus minor pilin ComGF Machinery gene
  CDO84_RS11375 (CDO84_11375) comGE 2285218..2285565 (-) 348 WP_040082640.1 competence type IV pilus minor pilin ComGE Machinery gene
  CDO84_RS11380 (CDO84_11380) comGD 2285549..2285980 (-) 432 WP_040082639.1 competence type IV pilus minor pilin ComGD Machinery gene
  CDO84_RS11385 (CDO84_11385) comGC 2285970..2286266 (-) 297 WP_019258890.1 comG operon protein ComGC Machinery gene
  CDO84_RS11390 (CDO84_11390) comGB 2286280..2287317 (-) 1038 WP_040082638.1 competence type IV pilus assembly protein ComGB Machinery gene
  CDO84_RS11395 (CDO84_11395) comGA 2287304..2288374 (-) 1071 WP_040082636.1 competence protein ComGA Machinery gene
  CDO84_RS21580 (CDO84_11400) - 2288337..2288555 (-) 219 WP_040082635.1 hypothetical protein -
  CDO84_RS11405 (CDO84_11405) - 2288586..2288996 (-) 411 WP_040082633.1 CBS domain-containing protein -

Sequence


Protein


Download         Length: 124 a.a.        Molecular weight: 14392.71 Da        Isoelectric Point: 9.7477

>NTDB_id=234802 CDO84_RS11365 WP_040082643.1 2284437..2284811(-) (comGG) [Bacillus sp. MD-5]
MYRTRGFIYPAVLFVSALVLLIVNFTAAQYISRCMFEKETKELYTGENLLQNGALLSIRHVLEQQKGQKGTQQFPYGQVS
YYIRDTSIKEQKEINLKVLTESGTERTALIVFDQKKKKMLSWTE

Nucleotide


Download         Length: 375 bp        

>NTDB_id=234802 CDO84_RS11365 WP_040082643.1 2284437..2284811(-) (comGG) [Bacillus sp. MD-5]
ATGTACCGTACGAGAGGGTTTATTTATCCAGCTGTTCTTTTTGTGTCAGCACTTGTGCTGTTAATCGTGAACTTTACTGC
TGCTCAATATATTTCACGCTGCATGTTTGAGAAGGAAACGAAAGAGTTATACACAGGAGAGAATTTGCTTCAGAATGGTG
CGCTTCTTTCAATTCGGCATGTTCTTGAGCAACAGAAAGGCCAGAAGGGTACGCAGCAATTTCCATATGGACAGGTTTCT
TATTACATTCGCGATACATCGATAAAAGAGCAAAAAGAAATCAACTTAAAAGTGTTAACGGAGTCGGGAACAGAAAGAAC
TGCACTGATCGTGTTTGATCAAAAAAAGAAAAAAATGCTGAGCTGGACAGAATAA

Domains


Predicted by InterProScan.

(30-124)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

87.097

100

0.871


Multiple sequence alignment