Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   CDO84_RS11330 Genome accession   NZ_CP021911
Coordinates   2280751..2280924 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus sp. MD-5     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2275751..2285924
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CDO84_RS11315 (CDO84_11315) gcvT 2276547..2277635 (-) 1089 WP_040082650.1 glycine cleavage system aminomethyltransferase GcvT -
  CDO84_RS11320 (CDO84_11320) - 2278079..2279752 (+) 1674 WP_040082648.1 SNF2-related protein -
  CDO84_RS11325 (CDO84_11325) - 2279773..2280567 (+) 795 WP_014664585.1 YqhG family protein -
  CDO84_RS11330 (CDO84_11330) sinI 2280751..2280924 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  CDO84_RS11335 (CDO84_11335) sinR 2280958..2281293 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  CDO84_RS11340 (CDO84_11340) tasA 2281387..2282172 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  CDO84_RS11345 (CDO84_11345) - 2282236..2282808 (-) 573 WP_014664587.1 signal peptidase I -
  CDO84_RS11350 (CDO84_11350) tapA 2282792..2283547 (-) 756 WP_014664588.1 amyloid fiber anchoring/assembly protein TapA -
  CDO84_RS11355 (CDO84_11355) - 2283819..2284145 (+) 327 WP_040082645.1 YqzG/YhdC family protein -
  CDO84_RS11360 (CDO84_11360) - 2284186..2284365 (-) 180 WP_014480252.1 YqzE family protein -
  CDO84_RS11365 (CDO84_11365) comGG 2284437..2284811 (-) 375 WP_040082643.1 competence type IV pilus minor pilin ComGG Machinery gene
  CDO84_RS11370 (CDO84_11370) comGF 2284812..2285192 (-) 381 WP_040082642.1 competence type IV pilus minor pilin ComGF Machinery gene
  CDO84_RS11375 (CDO84_11375) comGE 2285218..2285565 (-) 348 WP_040082640.1 competence type IV pilus minor pilin ComGE Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=234800 CDO84_RS11330 WP_003230187.1 2280751..2280924(+) (sinI) [Bacillus sp. MD-5]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=234800 CDO84_RS11330 WP_003230187.1 2280751..2280924(+) (sinI) [Bacillus sp. MD-5]
ATGAAAAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment