Detailed information NTG0219394

Bioinformatically predicted

Overview

• Name: comYD
• Type: Machinery gene
• Locus tag: B1H24_RS01165
• Genome accession: NZ_CP019978
• Coordinates: 199304..199717 (+)
• Length: 137 a.a.
• NCBI ID: WP_000244261.1
• Uniprot ID: -
• Organism: Streptococcus agalactiae strain Sag37
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 194304..204717

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
B1H24_RS01140 (B1H24_01140)	-	196557..196922 (+)	366	WP_000285373.1	DUF1033 family protein	-
B1H24_RS01150 (B1H24_01150)	comYA	197095..198066 (+)	972	WP_000250805.1	competence type IV pilus ATPase ComGA	Machinery gene
B1H24_RS01155 (B1H24_01155)	comYB	197960..199003 (+)	1044	WP_223295889.1	competence type IV pilus assembly protein ComGB	Machinery gene
B1H24_RS01160 (B1H24_01160)	comGC/cglC	199000..199329 (+)	330	WP_000793380.1	competence type IV pilus major pilin ComGC	Machinery gene
B1H24_RS01165 (B1H24_01165)	comYD	199304..199717 (+)	414	WP_000244261.1	competence type IV pilus minor pilin ComGD	Machinery gene
B1H24_RS01170 (B1H24_01170)	comGE	199689..199988 (+)	300	WP_000234804.1	competence type IV pilus minor pilin ComGE	-
B1H24_RS01175 (B1H24_01175)	comGF	199942..200403 (+)	462	WP_001874812.1	competence type IV pilus minor pilin ComGF	-
B1H24_RS01180 (B1H24_01180)	comGG	200381..200752 (+)	372	WP_000601104.1	competence type IV pilus minor pilin ComGG	-
B1H24_RS01185 (B1H24_01185)	comYH	200867..201841 (+)	975	WP_001008574.1	class I SAM-dependent methyltransferase	Machinery gene
B1H24_RS01190 (B1H24_01190)	-	201873..203066 (+)	1194	WP_000047534.1	acetate kinase	-
B1H24_RS01195 (B1H24_01195)	-	203218..203424 (+)	207	WP_000798241.1	helix-turn-helix transcriptional regulator	-
B1H24_RS01200 (B1H24_01200)	-	203483..203620 (+)	138	WP_001865900.1	hypothetical protein	-
B1H24_RS01205 (B1H24_01205)	-	203661..204116 (+)	456	WP_000905673.1	hypothetical protein	-

Sequence

Protein

• Length: 137 a.a.
• Molecular weight: 15968.43 Da
• Isoelectric Point: 9.9787

>NTDB_id=219394 B1H24_RS01165 WP_000244261.1 199304..199717(+) (comYD) [Streptococcus agalactiae strain Sag37]
MVLRKFQVKAFTVLESLIVLSVVAFMTLVFSTSFNNIFRQVEETIFFISFEHLYRDTQKLSAFGQKKQTLTISHNYLENT
YERLYLPKTVKVVKSDTLAFDTNGGNSSLAKIQFECYRKTVTYQLYIGSGNYRKKEN

Nucleotide

• Length: 414 bp

>NTDB_id=219394 B1H24_RS01165 WP_000244261.1 199304..199717(+) (comYD) [Streptococcus agalactiae strain Sag37]
ATGGTTCTCAGAAAATTTCAAGTTAAAGCATTTACTGTTTTGGAGAGCCTTATTGTATTATCAGTAGTGGCATTTATGAC
GTTAGTATTTTCAACATCATTTAATAATATTTTTAGGCAGGTTGAAGAAACAATTTTCTTCATATCCTTTGAACATCTTT
ATAGAGATACTCAGAAATTGAGTGCATTTGGTCAGAAGAAACAAACCCTTACAATCTCTCATAATTATCTCGAAAATACT
TATGAGAGACTTTATTTACCTAAAACTGTAAAAGTAGTCAAAAGTGATACACTTGCATTTGACACTAATGGAGGGAATTC
AAGCTTGGCAAAAATTCAATTTGAATGTTATAGAAAAACTGTCACGTATCAATTATATATAGGAAGTGGTAATTATCGTA
AGAAAGAAAATTAG

Domains

No domain identified.

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYD	Streptococcus mutans UA140	51.515	96.35	0.496
comYD	Streptococcus mutans UA159	51.515	96.35	0.496
comYD	Streptococcus gordonii str. Challis substr. CH1	47.407	98.54	0.467
comGD/cglD	Streptococcus mitis NCTC 12261	41.045	97.81	0.401
comGD/cglD	Streptococcus pneumoniae TIGR4	43.307	92.701	0.401
comGD/cglD	Streptococcus mitis SK321	43.307	92.701	0.401
comGD/cglD	Streptococcus pneumoniae Rx1	42.52	92.701	0.394
comGD/cglD	Streptococcus pneumoniae D39	42.52	92.701	0.394
comGD/cglD	Streptococcus pneumoniae R6	42.52	92.701	0.394