Detailed information
Overview
| Name | comA | Type | Regulator |
| Locus tag | B1761_RS10815 | Genome accession | NZ_CP019935 |
| Coordinates | 1317026..1317235 (+) | Length | 69 a.a. |
| NCBI ID | WP_002946147.1 | Uniprot ID | - |
| Organism | Streptococcus thermophilus strain APC151 | ||
| Function | processing and transport of ComC (predicted from homology) Competence regulation |
||
Genomic Context
Location: 1312026..1322235
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| B1761_RS07110 (B1761_07195) | - | 1312464..1312973 (+) | 510 | WP_014607952.1 | tRNA (cytidine(34)-2'-O)-methyltransferase | - |
| B1761_RS07115 (B1761_07200) | - | 1313285..1313842 (+) | 558 | WP_002949523.1 | ECF transporter S component | - |
| B1761_RS07120 (B1761_07205) | - | 1313845..1314495 (+) | 651 | WP_011225447.1 | phosphatase PAP2 family protein | - |
| B1761_RS07125 (B1761_07210) | comR | 1314690..1315589 (+) | 900 | WP_014607953.1 | helix-turn-helix domain-containing protein | Regulator |
| B1761_RS10805 | - | 1315827..1316258 (+) | 432 | Protein_1305 | cysteine peptidase family C39 domain-containing protein | - |
| B1761_RS10810 | - | 1316288..1316953 (+) | 666 | Protein_1306 | ABC transporter transmembrane domain-containing protein | - |
| B1761_RS10815 | comA | 1317026..1317235 (+) | 210 | WP_002946147.1 | hypothetical protein | Regulator |
| B1761_RS07155 (B1761_07235) | - | 1317290..1317858 (+) | 569 | Protein_1308 | ATP-binding cassette domain-containing protein | - |
| B1761_RS07160 (B1761_07240) | - | 1317966..1318283 (+) | 318 | WP_011225454.1 | DUF805 domain-containing protein | - |
| B1761_RS10820 | - | 1318246..1318530 (-) | 285 | WP_014727318.1 | hypothetical protein | - |
| B1761_RS10825 | - | 1318770..1319666 (-) | 897 | WP_224102957.1 | urease cluster protein | - |
| B1761_RS07170 (B1761_07250) | - | 1320071..1320586 (+) | 516 | WP_002949547.1 | AmiS/UreI family transporter | - |
| B1761_RS07175 (B1761_07255) | - | 1320611..1320913 (+) | 303 | WP_002886558.1 | urease subunit gamma | - |
| B1761_RS07180 (B1761_07260) | - | 1320925..1321236 (+) | 312 | WP_002886559.1 | urease subunit beta | - |
Sequence
Protein
Download Length: 69 a.a. Molecular weight: 8157.54 Da Isoelectric Point: 9.7339
>NTDB_id=218959 B1761_RS10815 WP_002946147.1 1317026..1317235(+) (comA) [Streptococcus thermophilus strain APC151]
MITYSMLLNYFTTPLINIIYLQSKIQQAKVANNCLQEVYVVNKEEKGQLKDLSFKQLDLKGVSHRFRYQ
MITYSMLLNYFTTPLINIIYLQSKIQQAKVANNCLQEVYVVNKEEKGQLKDLSFKQLDLKGVSHRFRYQ
Nucleotide
Download Length: 210 bp
>NTDB_id=218959 B1761_RS10815 WP_002946147.1 1317026..1317235(+) (comA) [Streptococcus thermophilus strain APC151]
TTGATTACCTATAGTATGTTGCTTAATTATTTTACGACTCCTTTAATTAATATTATCTATCTTCAATCTAAGATTCAGCA
AGCCAAGGTAGCCAATAATTGTCTTCAAGAAGTTTATGTTGTGAATAAGGAAGAAAAAGGTCAACTCAAAGATTTATCCT
TTAAACAATTAGACTTAAAAGGTGTTAGTCATCGTTTCAGATACCAATAA
TTGATTACCTATAGTATGTTGCTTAATTATTTTACGACTCCTTTAATTAATATTATCTATCTTCAATCTAAGATTCAGCA
AGCCAAGGTAGCCAATAATTGTCTTCAAGAAGTTTATGTTGTGAATAAGGAAGAAAAAGGTCAACTCAAAGATTTATCCT
TTAAACAATTAGACTTAAAAGGTGTTAGTCATCGTTTCAGATACCAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comA | Streptococcus gordonii str. Challis substr. CH1 |
54.167 |
100 |
0.565 |
| comA | Streptococcus mitis NCTC 12261 |
52.778 |
100 |
0.551 |
| comA | Streptococcus pneumoniae Rx1 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae D39 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae R6 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae TIGR4 |
51.389 |
100 |
0.536 |
| comA | Streptococcus mitis SK321 |
50 |
100 |
0.522 |
| comA/nlmT | Streptococcus mutans UA159 |
44.286 |
100 |
0.449 |