Detailed information NTG0209802

Bioinformatically predicted

Overview

• Name: comGD
• Type: Machinery gene
• Locus tag: CR541_RS00810
• Genome accession: NZ_CP024050
• Coordinates: 121802..122209 (+)
• Length: 135 a.a.
• NCBI ID: WP_011921721.1
• Uniprot ID: A0A0H3MT39
• Organism: Streptococcus suis strain CS100322
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 116802..127209

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
CR541_RS00785 (CR541_00785)	-	118210..118575 (+)	366	WP_002936568.1	DUF1033 family protein	-
CR541_RS00790 (CR541_00790)	-	118610..119553 (-)	944	Protein_115	S66 peptidase family protein	-
CR541_RS00795 (CR541_00795)	comGA	119639..120589 (+)	951	WP_011921718.1	competence type IV pilus ATPase ComGA	Machinery gene
CR541_RS00800 (CR541_00800)	comGB	120501..121538 (+)	1038	WP_011921719.1	competence type IV pilus assembly protein ComGB	Machinery gene
CR541_RS00805 (CR541_00805)	comGC	121540..121821 (+)	282	WP_011921720.1	competence type IV pilus major pilin ComGC	Machinery gene
CR541_RS00810 (CR541_00810)	comGD	121802..122209 (+)	408	WP_011921721.1	competence type IV pilus minor pilin ComGD	Machinery gene
CR541_RS00815 (CR541_00815)	comGE	122181..122474 (+)	294	WP_011921722.1	competence type IV pilus minor pilin ComGE	Machinery gene
CR541_RS00820 (CR541_00820)	comGF/cglF	122461..122895 (+)	435	WP_011922561.1	competence type IV pilus minor pilin ComGF	Machinery gene
CR541_RS00825 (CR541_00825)	comGG	122873..123283 (+)	411	WP_011921724.1	competence type IV pilus minor pilin ComGG	Machinery gene
CR541_RS00830 (CR541_00830)	comGH	123340..124293 (+)	954	WP_011922562.1	class I SAM-dependent methyltransferase	Machinery gene
CR541_RS00835 (CR541_00835)	-	124343..125530 (+)	1188	WP_012775422.1	acetate kinase	-
CR541_RS00840 (CR541_00840)	-	125845..126396 (+)	552	WP_012774908.1	folate family ECF transporter S component	-

Sequence

Protein

• Length: 135 a.a.
• Molecular weight: 15367.59 Da
• Isoelectric Point: 8.3926

>NTDB_id=209802 CR541_RS00810 WP_011921721.1 121802..122209(+) (comGD) [Streptococcus suis strain CS100322]
MLRRKNKAFTLFESLLTLLVVSFLAVSLSGTVQTVFRSVQEEIFLWEFEAIYKDSQKLAASSHKKVNLAIGGQEVTNGYQ
AVEVPRNVEVLEEKTIQFEEDGGNSSLTKIRFHLSQKIVTYQLYIGSGRYKKTEE

Nucleotide

• Length: 408 bp

>NTDB_id=209802 CR541_RS00810 WP_011921721.1 121802..122209(+) (comGD) [Streptococcus suis strain CS100322]
ATGCTACGGCGAAAAAATAAGGCTTTTACCCTGTTTGAAAGCCTGCTGACCTTGTTGGTTGTCAGTTTTTTAGCTGTTTC
CTTATCAGGAACAGTACAAACGGTCTTTCGGTCTGTTCAGGAAGAAATTTTTCTCTGGGAATTTGAGGCCATCTATAAAG
ACAGTCAGAAATTAGCAGCCAGTTCCCACAAAAAAGTGAACCTTGCTATCGGTGGACAGGAGGTTACAAATGGTTATCAG
GCTGTAGAGGTGCCCAGAAACGTAGAGGTCTTAGAGGAGAAAACTATTCAGTTTGAAGAAGATGGTGGAAATTCTTCTCT
GACCAAGATTCGTTTTCACCTTAGTCAAAAAATAGTCACGTATCAATTATATATAGGGAGTGGTCGCTATAAGAAAACAG
AAGAATAA

Domains

No domain identified.

3D structure

• AlphaFold DB: A0A0H3MT39

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGD	Streptococcus gordonii str. Challis substr. CH1	48.031	94.074	0.452
comGD	Streptococcus mutans UA140	46.512	95.556	0.444
comGD	Streptococcus mutans UA159	46.512	95.556	0.444
comGD/cglD	Streptococcus pneumoniae TIGR4	44.961	95.556	0.43
comGD/cglD	Streptococcus pneumoniae R6	44.961	95.556	0.43
comGD/cglD	Streptococcus pneumoniae Rx1	44.961	95.556	0.43
comGD/cglD	Streptococcus pneumoniae D39	44.961	95.556	0.43
comGD/cglD	Streptococcus mitis NCTC 12261	44.186	95.556	0.422
comGD/cglD	Streptococcus mitis SK321	43.411	95.556	0.415
comGD	Lactococcus lactis subsp. cremoris KW2	39.062	94.815	0.37