Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   BSF20_RS14595 Genome accession   NZ_CP018152
Coordinates   2794535..2794912 (+) Length   125 a.a.
NCBI ID   WP_014305410.1    Uniprot ID   -
Organism   Bacillus amyloliquefaciens strain LM2303     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2789535..2799912
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BSF20_RS14560 (BSF20_14265) - 2789845..2790795 (+) 951 WP_003153082.1 magnesium transporter CorA family protein -
  BSF20_RS14565 (BSF20_14270) comGA 2790993..2792063 (+) 1071 WP_057080484.1 competence type IV pilus ATPase ComGA Machinery gene
  BSF20_RS14570 (BSF20_14275) comGB 2792050..2793087 (+) 1038 WP_014305414.1 competence type IV pilus assembly protein ComGB Machinery gene
  BSF20_RS14575 (BSF20_14280) comGC 2793092..2793400 (+) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  BSF20_RS14580 (BSF20_14285) comGD 2793390..2793827 (+) 438 WP_072588444.1 competence type IV pilus minor pilin ComGD Machinery gene
  BSF20_RS14585 (BSF20_14290) comGE 2793811..2794125 (+) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  BSF20_RS14590 (BSF20_14295) comGF 2794139..2794534 (+) 396 WP_003153090.1 competence type IV pilus minor pilin ComGF -
  BSF20_RS14595 (BSF20_14300) comGG 2794535..2794912 (+) 378 WP_014305410.1 competence type IV pilus minor pilin ComGG Machinery gene
  BSF20_RS14600 (BSF20_14305) - 2794969..2795148 (+) 180 WP_003153093.1 YqzE family protein -
  BSF20_RS14605 (BSF20_14310) - 2795188..2795517 (-) 330 WP_003153097.1 DUF3889 domain-containing protein -
  BSF20_RS14610 (BSF20_14315) tapA 2795776..2796447 (+) 672 WP_003153099.1 amyloid fiber anchoring/assembly protein TapA -
  BSF20_RS14615 (BSF20_14320) sipW 2796419..2797003 (+) 585 WP_003153100.1 signal peptidase I SipW -
  BSF20_RS14620 (BSF20_14325) tasA 2797067..2797852 (+) 786 WP_003153102.1 biofilm matrix protein TasA -
  BSF20_RS14625 (BSF20_14330) sinR 2797900..2798235 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  BSF20_RS14630 (BSF20_14335) sinI 2798269..2798442 (-) 174 WP_003153105.1 anti-repressor SinI Regulator
  BSF20_RS14635 (BSF20_14340) - 2798619..2799413 (-) 795 WP_014305407.1 YqhG family protein -

Sequence


Protein


Download         Length: 125 a.a.        Molecular weight: 14170.14 Da        Isoelectric Point: 9.9592

>NTDB_id=206550 BSF20_RS14595 WP_014305410.1 2794535..2794912(+) (comGG) [Bacillus amyloliquefaciens strain LM2303]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMTQGQKVQTGTQRFPYGTVS
FRITGSDRRETVQVTIQAETVSGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=206550 BSF20_RS14595 WP_014305410.1 2794535..2794912(+) (comGG) [Bacillus amyloliquefaciens strain LM2303]
ATGTACAAATCTGACGGTTTTATCTATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCGAAAGAGGCCGGGGAGTACTGGATCGGAGAGAATCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTACGGAACTGTTTCC
TTCCGCATCACCGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCCGAAACAGTGTCAGGCACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains


Predicted by InterproScan.

(30-124)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

51.613

99.2

0.512


Multiple sequence alignment