Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | BSF20_RS14630 | Genome accession | NZ_CP018152 |
| Coordinates | 2798269..2798442 (-) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus amyloliquefaciens strain LM2303 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2793269..2803442
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BSF20_RS14580 (BSF20_14285) | comGD | 2793390..2793827 (+) | 438 | WP_072588444.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| BSF20_RS14585 (BSF20_14290) | comGE | 2793811..2794125 (+) | 315 | WP_015388003.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| BSF20_RS14590 (BSF20_14295) | comGF | 2794139..2794534 (+) | 396 | WP_003153090.1 | competence type IV pilus minor pilin ComGF | - |
| BSF20_RS14595 (BSF20_14300) | comGG | 2794535..2794912 (+) | 378 | WP_014305410.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| BSF20_RS14600 (BSF20_14305) | - | 2794969..2795148 (+) | 180 | WP_003153093.1 | YqzE family protein | - |
| BSF20_RS14605 (BSF20_14310) | - | 2795188..2795517 (-) | 330 | WP_003153097.1 | DUF3889 domain-containing protein | - |
| BSF20_RS14610 (BSF20_14315) | tapA | 2795776..2796447 (+) | 672 | WP_003153099.1 | amyloid fiber anchoring/assembly protein TapA | - |
| BSF20_RS14615 (BSF20_14320) | sipW | 2796419..2797003 (+) | 585 | WP_003153100.1 | signal peptidase I SipW | - |
| BSF20_RS14620 (BSF20_14325) | tasA | 2797067..2797852 (+) | 786 | WP_003153102.1 | biofilm matrix protein TasA | - |
| BSF20_RS14625 (BSF20_14330) | sinR | 2797900..2798235 (-) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| BSF20_RS14630 (BSF20_14335) | sinI | 2798269..2798442 (-) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| BSF20_RS14635 (BSF20_14340) | - | 2798619..2799413 (-) | 795 | WP_014305407.1 | YqhG family protein | - |
| BSF20_RS14640 (BSF20_14345) | - | 2799431..2801101 (-) | 1671 | WP_003153107.1 | DEAD/DEAH box helicase | - |
| BSF20_RS14645 (BSF20_14350) | gcvT | 2801524..2802624 (+) | 1101 | WP_058906182.1 | glycine cleavage system aminomethyltransferase GcvT | - |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=206552 BSF20_RS14630 WP_003153105.1 2798269..2798442(-) (sinI) [Bacillus amyloliquefaciens strain LM2303]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=206552 BSF20_RS14630 WP_003153105.1 2798269..2798442(-) (sinI) [Bacillus amyloliquefaciens strain LM2303]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |