Detailed information
Overview
| Name | stkP | Type | Regulator |
| Locus tag | BBN63_RS36970 | Genome accession | NZ_CP018047 |
| Coordinates | 7977308..7977412 (+) | Length | 34 a.a. |
| NCBI ID | WP_237285857.1 | Uniprot ID | - |
| Organism | Streptomyces niveus strain SCSIO 3406 | ||
| Function | phosphorylate ComE (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| IS/Tn | 7977715..7978815 | 7977308..7977412 | flank | 303 |
Gene organization within MGE regions
Location: 7977308..7978815
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BBN63_RS36970 | stkP | 7977308..7977412 (+) | 105 | WP_237285857.1 | protein kinase domain-containing protein | Regulator |
| BBN63_RS35125 (BBN63_34450) | - | 7977772..7978717 (+) | 946 | Protein_6955 | IS481 family transposase | - |
Sequence
Protein
Download Length: 34 a.a. Molecular weight: 3673.27 Da Isoelectric Point: 7.2007
>NTDB_id=205346 BBN63_RS36970 WP_237285857.1 7977308..7977412(+) (stkP) [Streptomyces niveus strain SCSIO 3406]
MHEAGLTHRDIKPSNIMVLPDGGAKVVDFGRPTL
MHEAGLTHRDIKPSNIMVLPDGGAKVVDFGRPTL
Nucleotide
Download Length: 105 bp
>NTDB_id=205346 BBN63_RS36970 WP_237285857.1 7977308..7977412(+) (stkP) [Streptomyces niveus strain SCSIO 3406]
GTGCACGAAGCGGGACTGACGCACCGGGACATCAAGCCGTCCAACATCATGGTCCTGCCTGACGGCGGGGCGAAGGTGGT
CGACTTCGGGCGGCCGACGCTATGA
GTGCACGAAGCGGGACTGACGCACCGGGACATCAAGCCGTCCAACATCATGGTCCTGCCTGACGGCGGGGCGAAGGTGGT
CGACTTCGGGCGGCCGACGCTATGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| stkP | Streptococcus pneumoniae Rx1 |
62.069 |
85.294 |
0.529 |
| stkP | Streptococcus pneumoniae D39 |
62.069 |
85.294 |
0.529 |
| stkP | Streptococcus pneumoniae R6 |
62.069 |
85.294 |
0.529 |
| stkP | Streptococcus pneumoniae TIGR4 |
62.069 |
85.294 |
0.529 |
| stkP/pknB | Streptococcus salivarius strain HSISS4 |
55.172 |
85.294 |
0.471 |
| pknB | Streptococcus mutans UA159 |
55.172 |
85.294 |
0.471 |