Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGD   Type   Machinery gene
Locus tag   BK055_RS12815 Genome accession   NZ_CP017775
Coordinates   2629536..2629973 (-) Length   145 a.a.
NCBI ID   WP_007612572.1    Uniprot ID   -
Organism   Bacillus velezensis strain 9912D     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2624536..2634973
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BK055_RS12765 (BK055_12765) sinI 2624919..2625092 (+) 174 WP_014418369.1 anti-repressor SinI Regulator
  BK055_RS12770 (BK055_12770) sinR 2625126..2625461 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  BK055_RS12775 (BK055_12775) tasA 2625509..2626294 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  BK055_RS12780 (BK055_12780) sipW 2626359..2626943 (-) 585 WP_014418370.1 signal peptidase I SipW -
  BK055_RS12785 (BK055_12785) tapA 2626915..2627586 (-) 672 WP_025649852.1 amyloid fiber anchoring/assembly protein TapA -
  BK055_RS12790 (BK055_12790) - 2627845..2628174 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  BK055_RS12795 (BK055_12795) - 2628215..2628394 (-) 180 WP_003153093.1 YqzE family protein -
  BK055_RS12800 (BK055_12800) comGG 2628451..2628828 (-) 378 WP_025649851.1 competence type IV pilus minor pilin ComGG Machinery gene
  BK055_RS12805 (BK055_12805) comGF 2628829..2629224 (-) 396 WP_025649850.1 competence type IV pilus minor pilin ComGF -
  BK055_RS12810 (BK055_12810) comGE 2629238..2629552 (-) 315 WP_017418140.1 competence type IV pilus minor pilin ComGE Machinery gene
  BK055_RS12815 (BK055_12815) comGD 2629536..2629973 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  BK055_RS12820 (BK055_12820) comGC 2629963..2630229 (-) 267 WP_050496152.1 competence type IV pilus major pilin ComGC Machinery gene
  BK055_RS12825 (BK055_12825) comGB 2630276..2631313 (-) 1038 WP_071181847.1 competence type IV pilus assembly protein ComGB Machinery gene
  BK055_RS12830 (BK055_12830) comGA 2631300..2632370 (-) 1071 WP_012117985.1 competence type IV pilus ATPase ComGA Machinery gene
  BK055_RS12835 (BK055_12835) - 2632563..2633513 (-) 951 WP_071181848.1 magnesium transporter CorA family protein -
  BK055_RS12840 (BK055_12840) - 2633659..2634960 (+) 1302 WP_071181849.1 hemolysin family protein -

Sequence


Protein


Download         Length: 145 a.a.        Molecular weight: 16254.76 Da        Isoelectric Point: 10.1850

>NTDB_id=202818 BK055_RS12815 WP_007612572.1 2629536..2629973(-) (comGD) [Bacillus velezensis strain 9912D]
MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPVCTHLAVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPKEHKYK
LQSGGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIQLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide


Download         Length: 438 bp        

>NTDB_id=202818 BK055_RS12815 WP_007612572.1 2629536..2629973(-) (comGD) [Bacillus velezensis strain 9912D]
TTGAACAATAACAGGCGGACAGAAAATGGGTTTACCCTTCTTGAAAGCCTGATTGTGTTAAGCCTGGCGTCCGTCCTGCT
GACGGTTTTGTTCACGACGGTTCCGCCGGTCTGCACCCACCTTGCCGTGCGGCAAAAAACAGAACAGCTCCAAAAAGATA
TTCAGCTTGCTCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAAAGAGCATAAATACAAA
CTGCAGTCAGGCGGAAGGATTGTCGAGCGTTCTTTTGATTCGCTTCACATTACGCTTGTGACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATACAATTGAAGAGCGCCGGGTTCACCTATGAGATCACAGTTT
ACTTAGGGAGCGGAAATGTCCATGCTAAACGGAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Bacillus subtilis subsp. subtilis str. 168

55.479

100

0.559


Multiple sequence alignment