Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | BK055_RS12765 | Genome accession | NZ_CP017775 |
| Coordinates | 2624919..2625092 (+) | Length | 57 a.a. |
| NCBI ID | WP_014418369.1 | Uniprot ID | I2C7P2 |
| Organism | Bacillus velezensis strain 9912D | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2619919..2630092
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BK055_RS12750 (BK055_12750) | gcvT | 2620732..2621832 (-) | 1101 | WP_071181846.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| BK055_RS12755 (BK055_12755) | - | 2622256..2623926 (+) | 1671 | WP_017418135.1 | DEAD/DEAH box helicase | - |
| BK055_RS12760 (BK055_12760) | - | 2623948..2624742 (+) | 795 | WP_014305407.1 | YqhG family protein | - |
| BK055_RS12765 (BK055_12765) | sinI | 2624919..2625092 (+) | 174 | WP_014418369.1 | anti-repressor SinI | Regulator |
| BK055_RS12770 (BK055_12770) | sinR | 2625126..2625461 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| BK055_RS12775 (BK055_12775) | tasA | 2625509..2626294 (-) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| BK055_RS12780 (BK055_12780) | sipW | 2626359..2626943 (-) | 585 | WP_014418370.1 | signal peptidase I SipW | - |
| BK055_RS12785 (BK055_12785) | tapA | 2626915..2627586 (-) | 672 | WP_025649852.1 | amyloid fiber anchoring/assembly protein TapA | - |
| BK055_RS12790 (BK055_12790) | - | 2627845..2628174 (+) | 330 | WP_012117979.1 | DUF3889 domain-containing protein | - |
| BK055_RS12795 (BK055_12795) | - | 2628215..2628394 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| BK055_RS12800 (BK055_12800) | comGG | 2628451..2628828 (-) | 378 | WP_025649851.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| BK055_RS12805 (BK055_12805) | comGF | 2628829..2629224 (-) | 396 | WP_025649850.1 | competence type IV pilus minor pilin ComGF | - |
| BK055_RS12810 (BK055_12810) | comGE | 2629238..2629552 (-) | 315 | WP_017418140.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| BK055_RS12815 (BK055_12815) | comGD | 2629536..2629973 (-) | 438 | WP_007612572.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6642.60 Da Isoelectric Point: 9.8168
>NTDB_id=202814 BK055_RS12765 WP_014418369.1 2624919..2625092(+) (sinI) [Bacillus velezensis strain 9912D]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=202814 BK055_RS12765 WP_014418369.1 2624919..2625092(+) (sinI) [Bacillus velezensis strain 9912D]
ATGAAAAATGCAAAAACAGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAACAGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
71.93 |
100 |
0.719 |