Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   BK055_RS12800 Genome accession   NZ_CP017775
Coordinates   2628451..2628828 (-) Length   125 a.a.
NCBI ID   WP_025649851.1    Uniprot ID   -
Organism   Bacillus velezensis strain 9912D     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2623451..2633828
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BK055_RS12760 (BK055_12760) - 2623948..2624742 (+) 795 WP_014305407.1 YqhG family protein -
  BK055_RS12765 (BK055_12765) sinI 2624919..2625092 (+) 174 WP_014418369.1 anti-repressor SinI Regulator
  BK055_RS12770 (BK055_12770) sinR 2625126..2625461 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  BK055_RS12775 (BK055_12775) tasA 2625509..2626294 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  BK055_RS12780 (BK055_12780) sipW 2626359..2626943 (-) 585 WP_014418370.1 signal peptidase I SipW -
  BK055_RS12785 (BK055_12785) tapA 2626915..2627586 (-) 672 WP_025649852.1 amyloid fiber anchoring/assembly protein TapA -
  BK055_RS12790 (BK055_12790) - 2627845..2628174 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  BK055_RS12795 (BK055_12795) - 2628215..2628394 (-) 180 WP_003153093.1 YqzE family protein -
  BK055_RS12800 (BK055_12800) comGG 2628451..2628828 (-) 378 WP_025649851.1 competence type IV pilus minor pilin ComGG Machinery gene
  BK055_RS12805 (BK055_12805) comGF 2628829..2629224 (-) 396 WP_025649850.1 competence type IV pilus minor pilin ComGF -
  BK055_RS12810 (BK055_12810) comGE 2629238..2629552 (-) 315 WP_017418140.1 competence type IV pilus minor pilin ComGE Machinery gene
  BK055_RS12815 (BK055_12815) comGD 2629536..2629973 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  BK055_RS12820 (BK055_12820) comGC 2629963..2630229 (-) 267 WP_050496152.1 competence type IV pilus major pilin ComGC Machinery gene
  BK055_RS12825 (BK055_12825) comGB 2630276..2631313 (-) 1038 WP_071181847.1 competence type IV pilus assembly protein ComGB Machinery gene
  BK055_RS12830 (BK055_12830) comGA 2631300..2632370 (-) 1071 WP_012117985.1 competence type IV pilus ATPase ComGA Machinery gene
  BK055_RS12835 (BK055_12835) - 2632563..2633513 (-) 951 WP_071181848.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 125 a.a.        Molecular weight: 14151.04 Da        Isoelectric Point: 9.6404

>NTDB_id=202816 BK055_RS12800 WP_025649851.1 2628451..2628828(-) (comGG) [Bacillus velezensis strain 9912D]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMTQGQKGQTGTQRFPYGTVS
FYITGSDRRETVQVTIQAETTTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=202816 BK055_RS12800 WP_025649851.1 2628451..2628828(-) (comGG) [Bacillus velezensis strain 9912D]
ATGTACAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCCGGGGAGTACTGGATCGGAGAGAACCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGGCCAAACTGGTACACAGCGTTTTCCGTACGGCACCGTTTCT
TTTTACATCACCGGGAGTGATCGAAGGGAAACGGTTCAGGTTACAATTCAGGCGGAAACCACGACAGGCACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains


Predicted by InterproScan.

(30-124)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

52.419

99.2

0.52


Multiple sequence alignment