Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   BKP58_RS21565 Genome accession   NZ_CP017763
Coordinates   4031576..4031950 (+) Length   124 a.a.
NCBI ID   WP_014480253.1    Uniprot ID   A0AA96ZSW7
Organism   Bacillus subtilis strain 29R7-12     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 4026576..4036950
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BKP58_RS21525 (BKP58_21475) corA 4026646..4027599 (+) 954 WP_014480260.1 magnesium transporter CorA -
  BKP58_RS21530 (BKP58_21480) - 4027601..4027798 (+) 198 WP_014480259.1 CBS domain-containing protein -
  BKP58_RS21535 (BKP58_21490) comGA 4028010..4029080 (+) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  BKP58_RS21540 (BKP58_21495) comGB 4029067..4030104 (+) 1038 WP_031600685.1 comG operon protein ComGB Machinery gene
  BKP58_RS21545 (BKP58_21500) comGC 4030118..4030414 (+) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  BKP58_RS21550 (BKP58_21505) comGD 4030404..4030835 (+) 432 WP_014480256.1 comG operon protein ComGD Machinery gene
  BKP58_RS21555 (BKP58_21510) comGE 4030819..4031166 (+) 348 WP_014480255.1 ComG operon protein 5 Machinery gene
  BKP58_RS21560 (BKP58_21515) comGF 4031192..4031575 (+) 384 WP_014480254.1 ComG operon protein ComGF Machinery gene
  BKP58_RS21565 (BKP58_21520) comGG 4031576..4031950 (+) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  BKP58_RS21570 (BKP58_21525) spoIITA 4032021..4032200 (+) 180 WP_014480252.1 YqzE family protein -
  BKP58_RS21575 (BKP58_21530) yqzG 4032242..4032568 (-) 327 WP_003246051.1 YqzG/YhdC family protein -
  BKP58_RS21580 (BKP58_21535) tapA 4032840..4033601 (+) 762 WP_014480251.1 amyloid fiber anchoring/assembly protein TapA -
  BKP58_RS21585 (BKP58_21540) sipW 4033585..4034157 (+) 573 WP_003230181.1 signal peptidase I SipW -
  BKP58_RS21590 (BKP58_21545) tasA 4034221..4035006 (+) 786 WP_014480250.1 biofilm matrix protein TasA -
  BKP58_RS21595 (BKP58_21550) sinR 4035099..4035434 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  BKP58_RS21600 (BKP58_21555) sinI 4035468..4035641 (-) 174 WP_003230187.1 anti-repressor SinI Regulator
  BKP58_RS21605 (BKP58_21560) yqhG 4035824..4036618 (-) 795 WP_014480249.1 YqhG family protein -

Sequence


Protein


Download         Length: 124 a.a.        Molecular weight: 14509.72 Da        Isoelectric Point: 9.2806

>NTDB_id=202710 BKP58_RS21565 WP_014480253.1 4031576..4031950(+) (comGG) [Bacillus subtilis strain 29R7-12]
MYRTRGFIYPAVLFVSALVLLIVNFAAAQYISRCMFEKETKELYIGENLLQNGVLLSIRHVLEERKGQEGTQQFPYGRVS
YYIHDTSIKEQKEINLRVSTESGTERTAQIVFDQKQKKLLRWTE

Nucleotide


Download         Length: 375 bp        

>NTDB_id=202710 BKP58_RS21565 WP_014480253.1 4031576..4031950(+) (comGG) [Bacillus subtilis strain 29R7-12]
ATGTATCGTACAAGAGGGTTTATTTATCCAGCTGTTCTTTTTGTGTCAGCGCTTGTGCTGTTAATCGTGAACTTTGCTGC
TGCTCAATATATTTCACGCTGCATGTTTGAAAAGGAAACAAAAGAGTTATACATAGGAGAGAATTTGCTTCAAAATGGGG
TGCTTCTTTCGATTCGGCATGTTCTAGAGGAACGGAAAGGCCAGGAGGGTACGCAGCAATTTCCATATGGACGGGTTTCT
TATTACATTCATGATACATCGATAAAAGAACAAAAAGAAATCAACTTAAGAGTGTCAACGGAGTCGGGAACAGAAAGAAC
TGCACAGATCGTATTTGATCAAAAACAGAAAAAACTGCTGAGATGGACAGAATAA

Domains


Predicted by InterproScan.

(30-124)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

97.581

100

0.976


Multiple sequence alignment