Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   BKP58_RS21600 Genome accession   NZ_CP017763
Coordinates   4035468..4035641 (-) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain 29R7-12     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 4030468..4040641
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BKP58_RS21555 (BKP58_21510) comGE 4030819..4031166 (+) 348 WP_014480255.1 ComG operon protein 5 Machinery gene
  BKP58_RS21560 (BKP58_21515) comGF 4031192..4031575 (+) 384 WP_014480254.1 ComG operon protein ComGF Machinery gene
  BKP58_RS21565 (BKP58_21520) comGG 4031576..4031950 (+) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  BKP58_RS21570 (BKP58_21525) spoIITA 4032021..4032200 (+) 180 WP_014480252.1 YqzE family protein -
  BKP58_RS21575 (BKP58_21530) yqzG 4032242..4032568 (-) 327 WP_003246051.1 YqzG/YhdC family protein -
  BKP58_RS21580 (BKP58_21535) tapA 4032840..4033601 (+) 762 WP_014480251.1 amyloid fiber anchoring/assembly protein TapA -
  BKP58_RS21585 (BKP58_21540) sipW 4033585..4034157 (+) 573 WP_003230181.1 signal peptidase I SipW -
  BKP58_RS21590 (BKP58_21545) tasA 4034221..4035006 (+) 786 WP_014480250.1 biofilm matrix protein TasA -
  BKP58_RS21595 (BKP58_21550) sinR 4035099..4035434 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  BKP58_RS21600 (BKP58_21555) sinI 4035468..4035641 (-) 174 WP_003230187.1 anti-repressor SinI Regulator
  BKP58_RS21605 (BKP58_21560) yqhG 4035824..4036618 (-) 795 WP_014480249.1 YqhG family protein -
  BKP58_RS21610 (BKP58_21565) hepAA 4036639..4038312 (-) 1674 WP_014480248.1 DEAD/DEAH box helicase -
  BKP58_RS21615 (BKP58_21570) gcvT 4038754..4039842 (+) 1089 WP_014480247.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=202712 BKP58_RS21600 WP_003230187.1 4035468..4035641(-) (sinI) [Bacillus subtilis strain 29R7-12]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=202712 BKP58_RS21600 WP_003230187.1 4035468..4035641(-) (sinI) [Bacillus subtilis strain 29R7-12]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment