Detailed information    

insolico Bioinformatically predicted

Overview


Name   pilV   Type   Machinery gene
Locus tag   ASO12_RS02420 Genome accession   NZ_CP016015
Coordinates   449828..450436 (+) Length   202 a.a.
NCBI ID   WP_003692820.1    Uniprot ID   -
Organism   Neisseria gonorrhoeae strain 32867     
Function   repress natural transformation (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 442130..488959 449828..450436 within 0


Gene organization within MGE regions


Location: 442130..488959
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ASO12_RS02380 (ASO12_02380) - 442130..443206 (-) 1077 WP_003687905.1 sulfate/molybdate ABC transporter ATP-binding protein -
  ASO12_RS02385 (ASO12_02385) cysW 443203..444063 (-) 861 WP_003687906.1 sulfate ABC transporter permease subunit CysW -
  ASO12_RS02390 (ASO12_02390) cysT 444252..445088 (-) 837 WP_003687907.1 sulfate ABC transporter permease subunit CysT -
  ASO12_RS02395 (ASO12_02395) - 445269..445601 (+) 333 WP_003687908.1 hypothetical protein -
  ASO12_RS02400 (ASO12_02400) - 445932..446441 (+) 510 WP_003687909.1 isoprenylcysteine carboxyl methyltransferase family protein -
  ASO12_RS02405 (ASO12_02405) - 446673..447254 (-) 582 WP_047918049.1 superoxide dismutase -
  ASO12_RS02410 (ASO12_02410) dnaB 447417..448823 (+) 1407 WP_003690896.1 replicative DNA helicase -
  ASO12_RS02415 (ASO12_02415) pilH 449131..449796 (+) 666 WP_047918678.1 GspH/FimT family pseudopilin Machinery gene
  ASO12_RS02420 (ASO12_02420) pilV 449828..450436 (+) 609 WP_003692820.1 type IV pilus modification protein PilV Machinery gene
  ASO12_RS02425 (ASO12_02425) pilJ 450433..451377 (+) 945 WP_047916984.1 PilW family protein Machinery gene
  ASO12_RS02430 (ASO12_02430) pilK 451356..451967 (+) 612 WP_047921729.1 pilus assembly PilX family protein Machinery gene
  ASO12_RS02435 (ASO12_02435) pilL 451969..452442 (+) 474 WP_180364901.1 PilX family type IV pilin Machinery gene
  ASO12_RS02440 (ASO12_02440) - 452512..452820 (-) 309 WP_010951048.1 AzlD family protein -
  ASO12_RS13850 - 452817..453524 (-) 708 Protein_456 AzlC family ABC transporter permease -
  ASO12_RS02450 (ASO12_02450) dut 453690..454142 (+) 453 WP_047918679.1 dUTP diphosphatase -
  ASO12_RS02455 (ASO12_02455) dapC 454218..455405 (+) 1188 WP_047918680.1 succinyldiaminopimelate transaminase -
  ASO12_RS02460 (ASO12_02460) yaaA 455716..456495 (+) 780 WP_047918681.1 peroxide stress protein YaaA -
  ASO12_RS02475 (ASO12_02475) - 457025..458217 (+) 1193 Protein_460 tyrosine-type recombinase/integrase -
  ASO12_RS02485 (ASO12_02485) - 458573..458842 (-) 270 WP_003687928.1 hypothetical protein -
  ASO12_RS02490 (ASO12_02490) - 459037..459720 (-) 684 WP_003687929.1 DUF2786 domain-containing protein -
  ASO12_RS14795 - 460000..460266 (-) 267 Protein_463 hypothetical protein -
  ASO12_RS02500 (ASO12_02500) - 460377..460592 (-) 216 WP_003691538.1 hypothetical protein -
  ASO12_RS02505 (ASO12_02505) - 460644..461135 (-) 492 WP_003691537.1 siphovirus Gp157 family protein -
  ASO12_RS02510 (ASO12_02510) - 461132..461314 (-) 183 WP_003691535.1 hypothetical protein -
  ASO12_RS02515 (ASO12_02515) - 461454..462140 (-) 687 WP_042758540.1 phage replication initiation protein, NGO0469 family -
  ASO12_RS02520 (ASO12_02520) - 462209..462370 (-) 162 WP_003691530.1 hypothetical protein -
  ASO12_RS02525 (ASO12_02525) - 462367..462645 (-) 279 WP_047921579.1 NGO1622 family putative holin -
  ASO12_RS02530 (ASO12_02530) - 462799..463131 (-) 333 WP_003695500.1 hypothetical protein -
  ASO12_RS02535 (ASO12_02535) - 463272..463559 (-) 288 WP_050171272.1 hypothetical protein -
  ASO12_RS02540 (ASO12_02540) - 463556..464032 (-) 477 WP_002255718.1 DUF6948 domain-containing protein -
  ASO12_RS02545 (ASO12_02545) - 464065..464265 (-) 201 WP_048654497.1 hypothetical protein -
  ASO12_RS02550 (ASO12_02550) - 464592..465152 (-) 561 WP_002231760.1 hypothetical protein -
  ASO12_RS02555 (ASO12_02555) - 465152..465850 (-) 699 WP_002255715.1 S24 family peptidase -
  ASO12_RS12350 - 465964..466194 (+) 231 WP_014580259.1 transcriptional regulator -
  ASO12_RS02560 (ASO12_02560) - 466297..467196 (+) 900 WP_050162082.1 replication protein -
  ASO12_RS02565 (ASO12_02565) - 467208..467987 (+) 780 WP_047917947.1 ATP-binding protein -
  ASO12_RS02570 (ASO12_02570) - 468057..468287 (+) 231 WP_003701140.1 hypothetical protein -
  ASO12_RS02575 (ASO12_02575) - 468301..468795 (+) 495 WP_041421248.1 DUF3310 domain-containing protein -
  ASO12_RS02580 (ASO12_02580) - 468972..469121 (+) 150 WP_003689110.1 hypothetical protein -
  ASO12_RS14800 - 469150..469431 (+) 282 WP_003689109.1 hypothetical protein -
  ASO12_RS02585 (ASO12_02585) - 469422..469859 (+) 438 WP_082280641.1 RusA family crossover junction endodeoxyribonuclease -
  ASO12_RS02590 (ASO12_02590) - 469852..470157 (+) 306 WP_003687981.1 nuclease domain-containing protein -
  ASO12_RS02595 (ASO12_02595) - 470154..470537 (+) 384 WP_003687982.1 recombination protein NinB -
  ASO12_RS02600 (ASO12_02600) - 470528..471046 (+) 519 WP_003687984.1 HNH endonuclease -
  ASO12_RS02605 (ASO12_02605) - 471112..471534 (+) 423 WP_003704254.1 hypothetical protein -
  ASO12_RS02610 (ASO12_02610) - 471534..471776 (+) 243 WP_003706439.1 hypothetical protein -
  ASO12_RS02615 (ASO12_02615) - 471831..472073 (+) 243 WP_003687989.1 hypothetical protein -
  ASO12_RS02620 (ASO12_02620) - 472054..473328 (+) 1275 WP_003687990.1 PBSX family phage terminase large subunit -
  ASO12_RS02625 (ASO12_02625) - 473313..475580 (+) 2268 WP_003687991.1 hypothetical protein -
  ASO12_RS02630 (ASO12_02630) - 475817..477013 (+) 1197 WP_003687992.1 hypothetical protein -
  ASO12_RS02635 (ASO12_02635) - 477010..484311 (+) 7302 WP_047919510.1 PLxRFG domain-containing protein -
  ASO12_RS02645 (ASO12_02645) - 484937..486229 (+) 1293 WP_003687995.1 DUF4043 family protein -
  ASO12_RS02650 (ASO12_02650) - 486284..486757 (+) 474 WP_003687996.1 hypothetical protein -
  ASO12_RS02655 (ASO12_02655) - 486763..487248 (+) 486 WP_003687997.1 hypothetical protein -
  ASO12_RS02660 (ASO12_02660) - 487245..487919 (+) 675 WP_003687998.1 hypothetical protein -
  ASO12_RS02665 (ASO12_02665) - 487910..488071 (+) 162 WP_003687999.1 hypothetical protein -
  ASO12_RS02670 (ASO12_02670) - 488108..488959 (-) 852 WP_050162101.1 Bro-N domain-containing protein -

Sequence


Protein


Download         Length: 202 a.a.        Molecular weight: 21963.00 Da        Isoelectric Point: 5.0254

>NTDB_id=185125 ASO12_RS02420 WP_003692820.1 449828..450436(+) (pilV) [Neisseria gonorrhoeae strain 32867]
MKNNDCLRLKNPQSGMALIEVLVAMLVLTIGILALLSVQLRTVASVREAETQTIVSQITQNLMEGMLMNPTIDSDSNKKN
YNLYMRNSIPSAVDGDFKVDAVKSKVQLADEQLKRFGYELKNALPDAVAIHYAVCKDSSGKAPALSGDAFSSNCDNKENG
DTLIKVLWVNDSAGDSDISRTNLEVSGGNIVYTYQARVGGRE

Nucleotide


Download         Length: 609 bp        

>NTDB_id=185125 ASO12_RS02420 WP_003692820.1 449828..450436(+) (pilV) [Neisseria gonorrhoeae strain 32867]
ATGAAGAATAATGATTGCTTGCGCCTGAAAAATCCCCAGTCCGGTATGGCGTTGATAGAAGTCTTGGTCGCTATGCTCGT
TCTGACCATCGGTATTTTGGCATTGCTGTCCGTACAGTTGCGGACAGTCGCTTCCGTCAGGGAGGCGGAAACGCAAACCA
TCGTCAGCCAAATCACGCAAAACCTGATGGAAGGAATGTTGATGAATCCGACCATTGATTCGGACAGCAACAAGAAAAAC
TATAATCTTTACATGAGAAACTCTATACCATCAGCTGTGGATGGCGATTTTAAGGTTGATGCCGTGAAAAGTAAGGTGCA
GTTGGCGGATGAACAATTGAAGAGATTTGGTTATGAGCTGAAAAATGCCTTGCCGGATGCGGTAGCTATTCATTACGCCG
TCTGCAAGGATTCGTCGGGTAAGGCGCCGGCATTGTCCGGCGATGCTTTTTCTTCAAATTGCGACAATAAGGAAAACGGG
GATACTTTAATTAAAGTATTGTGGGTAAATGATTCGGCAGGGGATTCGGATATTTCCCGTACGAATCTTGAGGTGAGCGG
CGGCAATATCGTATATACCTATCAGGCAAGGGTCGGAGGTCGTGAATGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  pilV Neisseria meningitidis 8013

89.806

100

0.916

  pilI Neisseria gonorrhoeae MS11

85.644

100

0.856

  pilV Neisseria gonorrhoeae MS11

85.644

100

0.856


Multiple sequence alignment