Detailed information NTG0181354

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: BSA145_RS20350
• Genome accession: NZ_CP015607
• Coordinates: 3891225..3891518 (-)
• Length: 97 a.a.
• NCBI ID: WP_024422977.1
• Uniprot ID: A0A0M2EIN6
• Organism: Bacillus safensis strain U14-5
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 3886225..3896518

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
BSA145_RS20300 (BSA145_19865)	sinR	3886388..3886723 (+)	336	WP_024422969.1	transcriptional regulator SinR	Regulator
BSA145_RS20305 (BSA145_19870)	tasA	3886791..3887591 (-)	801	WP_075623493.1	biofilm matrix protein TasA	-
BSA145_RS20310 (BSA145_19875)	sipW	3887649..3888221 (-)	573	WP_075623494.1	signal peptidase I SipW	-
BSA145_RS20315 (BSA145_19880)	tapA	3888274..3888801 (-)	528	WP_075623495.1	amyloid fiber anchoring/assembly protein TapA	-
BSA145_RS20320 (BSA145_19885)	-	3889102..3889380 (+)	279	WP_226014770.1	DUF3889 domain-containing protein	-
BSA145_RS20325 (BSA145_19890)	-	3889415..3889609 (-)	195	WP_075623734.1	YqzE family protein	-
BSA145_RS20330 (BSA145_19895)	-	3889669..3890052 (-)	384	WP_075623496.1	competence type IV pilus minor pilin ComGG	-
BSA145_RS20335 (BSA145_19900)	comGF	3890049..3890576 (-)	528	WP_257787572.1	competence type IV pilus minor pilin ComGF	-
BSA145_RS23120 (BSA145_19905)	comGE	3890488..3890802 (-)	315	WP_041106865.1	competence type IV pilus minor pilin ComGE	-
BSA145_RS20345 (BSA145_19910)	comGD	3890786..3891232 (-)	447	WP_075623497.1	competence type IV pilus minor pilin ComGD	-
BSA145_RS20350 (BSA145_19915)	comGC	3891225..3891518 (-)	294	WP_024422977.1	competence type IV pilus major pilin ComGC	Machinery gene
BSA145_RS22955	comGB	3891535..3891816 (-)	282	WP_231120659.1	type II secretion system F family protein	Machinery gene
BSA145_RS20355 (BSA145_19920)	-	3891828..3892574 (-)	747	WP_231120660.1	type II secretion system F family protein	-
BSA145_RS20360 (BSA145_19925)	comGA	3892555..3893640 (-)	1086	WP_075623498.1	competence type IV pilus ATPase ComGA	Machinery gene
BSA145_RS20365 (BSA145_19930)	-	3893818..3894693 (-)	876	WP_024422979.1	STAS domain-containing protein	-
BSA145_RS20375 (BSA145_19940)	-	3894917..3895297 (-)	381	WP_007501232.1	Spx/MgsR family RNA polymerase-binding regulatory protein	-
BSA145_RS20380 (BSA145_19945)	-	3895502..3895744 (+)	243	WP_003217440.1	DUF2626 domain-containing protein	-

Sequence

Protein

• Length: 97 a.a.
• Molecular weight: 10686.62 Da
• Isoelectric Point: 7.3218

>NTDB_id=181354 BSA145_RS20350 WP_024422977.1 3891225..3891518(-) (comGC) [Bacillus safensis strain U14-5]
MNDKGFTLLEMLIVMLVISILLLITIPNITRHHQAIQAKGCEGLKSMVSTQVMAYELEHDGKTPSLAELEKEGYVKKGLT
CPNGKAIVIQNGNVKHE

Nucleotide

• Length: 294 bp

>NTDB_id=181354 BSA145_RS20350 WP_024422977.1 3891225..3891518(-) (comGC) [Bacillus safensis strain U14-5]
ATGAATGATAAAGGATTTACCCTGTTAGAAATGTTAATAGTCATGCTCGTAATATCCATTCTTTTACTCATTACCATACC
AAATATCACACGTCATCACCAAGCTATTCAGGCAAAGGGCTGTGAAGGGCTTAAATCAATGGTCAGCACACAAGTGATGG
CATATGAATTGGAGCATGATGGGAAGACGCCATCTTTAGCTGAATTAGAAAAAGAAGGTTATGTCAAAAAGGGATTAACT
TGTCCTAATGGAAAAGCGATTGTCATTCAAAACGGCAACGTGAAGCATGAATAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (2-25)

3D structure

• AlphaFold DB: A0A0M2EIN6

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Bacillus subtilis subsp. subtilis str. 168	67.01	100	0.67
comGC	Staphylococcus aureus MW2	42.222	92.784	0.392
comGC	Staphylococcus aureus N315	42.222	92.784	0.392