Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGB   Type   Machinery gene
Locus tag   BSA145_RS22955 Genome accession   NZ_CP015607
Coordinates   3891535..3891816 (-) Length   93 a.a.
NCBI ID   WP_231120659.1    Uniprot ID   -
Organism   Bacillus safensis strain U14-5     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 3886535..3896816
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BSA145_RS20305 (BSA145_19870) tasA 3886791..3887591 (-) 801 WP_075623493.1 biofilm matrix protein TasA -
  BSA145_RS20310 (BSA145_19875) sipW 3887649..3888221 (-) 573 WP_075623494.1 signal peptidase I SipW -
  BSA145_RS20315 (BSA145_19880) tapA 3888274..3888801 (-) 528 WP_075623495.1 amyloid fiber anchoring/assembly protein TapA -
  BSA145_RS20320 (BSA145_19885) - 3889102..3889380 (+) 279 WP_226014770.1 DUF3889 domain-containing protein -
  BSA145_RS20325 (BSA145_19890) - 3889415..3889609 (-) 195 WP_075623734.1 YqzE family protein -
  BSA145_RS20330 (BSA145_19895) - 3889669..3890052 (-) 384 WP_075623496.1 competence type IV pilus minor pilin ComGG -
  BSA145_RS20335 (BSA145_19900) comGF 3890049..3890576 (-) 528 WP_257787572.1 competence type IV pilus minor pilin ComGF -
  BSA145_RS23120 (BSA145_19905) comGE 3890488..3890802 (-) 315 WP_041106865.1 competence type IV pilus minor pilin ComGE -
  BSA145_RS20345 (BSA145_19910) comGD 3890786..3891232 (-) 447 WP_075623497.1 competence type IV pilus minor pilin ComGD -
  BSA145_RS20350 (BSA145_19915) comGC 3891225..3891518 (-) 294 WP_024422977.1 competence type IV pilus major pilin ComGC Machinery gene
  BSA145_RS22955 comGB 3891535..3891816 (-) 282 WP_231120659.1 type II secretion system F family protein Machinery gene
  BSA145_RS20355 (BSA145_19920) - 3891828..3892574 (-) 747 WP_231120660.1 type II secretion system F family protein -
  BSA145_RS20360 (BSA145_19925) comGA 3892555..3893640 (-) 1086 WP_075623498.1 competence type IV pilus ATPase ComGA Machinery gene
  BSA145_RS20365 (BSA145_19930) - 3893818..3894693 (-) 876 WP_024422979.1 STAS domain-containing protein -
  BSA145_RS20375 (BSA145_19940) - 3894917..3895297 (-) 381 WP_007501232.1 Spx/MgsR family RNA polymerase-binding regulatory protein -
  BSA145_RS20380 (BSA145_19945) - 3895502..3895744 (+) 243 WP_003217440.1 DUF2626 domain-containing protein -

Sequence

Protein


Download         Length: 93 a.a.        Molecular weight: 10720.71 Da        Isoelectric Point: 6.2128

>NTDB_id=181359 BSA145_RS22955 WP_231120659.1 3891535..3891816(-) (comGB) [Bacillus safensis strain U14-5]
MGELRKGESMAHQVSVSPFFEKHFAAIIKHGEASGMLAREMYTYSQFLLENAELKIEKWISWLQPVIYGVTALLILIVYL
SILLPMYQLMEQV

Nucleotide


Download         Length: 282 bp        

>NTDB_id=181359 BSA145_RS22955 WP_231120659.1 3891535..3891816(-) (comGB) [Bacillus safensis strain U14-5]
ATGGGAGAGTTAAGAAAAGGAGAAAGCATGGCCCATCAAGTAAGCGTGTCTCCTTTTTTCGAAAAACATTTTGCAGCCAT
CATCAAGCATGGTGAAGCCAGCGGAATGCTTGCGAGAGAAATGTACACGTACAGCCAATTTCTATTAGAGAATGCAGAGC
TAAAAATTGAAAAATGGATTTCTTGGCTGCAGCCAGTTATTTATGGGGTAACAGCACTTCTTATACTCATCGTGTATTTA
TCTATTCTTTTACCAATGTATCAACTAATGGAGCAAGTGTAA

Domains

Predicted by InterproScan.

Type II secretion system (T2SS), protein F (T2SSF)

(3-85)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGB Bacillus subtilis subsp. subtilis str. 168

49.451

97.849

0.484

Multiple sequence alignment