Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   A1D33_RS16780 Genome accession   NZ_CP015443
Coordinates   3530087..3530464 (+) Length   125 a.a.
NCBI ID   WP_015417814.1    Uniprot ID   -
Organism   Bacillus velezensis strain CC09     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 3525087..3535464
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  A1D33_RS16745 (A1D33_016740) - 3525402..3526352 (+) 951 WP_015417820.1 magnesium transporter CorA family protein -
  A1D33_RS16750 (A1D33_016745) comGA 3526545..3527615 (+) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  A1D33_RS16755 (A1D33_016750) comGB 3527602..3528639 (+) 1038 WP_015417819.1 competence type IV pilus assembly protein ComGB Machinery gene
  A1D33_RS16760 (A1D33_016755) comGC 3528686..3528952 (+) 267 WP_050515801.1 competence type IV pilus major pilin ComGC Machinery gene
  A1D33_RS16765 (A1D33_016760) comGD 3528942..3529379 (+) 438 WP_015417817.1 competence type IV pilus minor pilin ComGD Machinery gene
  A1D33_RS16770 (A1D33_016765) comGE 3529363..3529677 (+) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  A1D33_RS16775 (A1D33_016770) comGF 3529586..3530086 (+) 501 WP_257738552.1 competence type IV pilus minor pilin ComGF -
  A1D33_RS16780 (A1D33_016775) comGG 3530087..3530464 (+) 378 WP_015417814.1 competence type IV pilus minor pilin ComGG Machinery gene
  A1D33_RS16785 (A1D33_016780) - 3530521..3530700 (+) 180 WP_003153093.1 YqzE family protein -
  A1D33_RS16790 (A1D33_016785) - 3530740..3531069 (-) 330 WP_039254490.1 DUF3889 domain-containing protein -
  A1D33_RS16795 (A1D33_016790) tapA 3531328..3531999 (+) 672 WP_031378945.1 amyloid fiber anchoring/assembly protein TapA -
  A1D33_RS16800 (A1D33_016795) sipW 3531971..3532555 (+) 585 WP_015240205.1 signal peptidase I SipW -
  A1D33_RS16805 (A1D33_016800) tasA 3532620..3533405 (+) 786 WP_007408329.1 biofilm matrix protein TasA -
  A1D33_RS16810 (A1D33_016805) sinR 3533453..3533788 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  A1D33_RS16815 (A1D33_016810) sinI 3533822..3533995 (-) 174 WP_003153105.1 anti-repressor SinI Regulator
  A1D33_RS16820 (A1D33_016815) - 3534172..3534966 (-) 795 WP_007408330.1 YqhG family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14167.09 Da        Isoelectric Point: 9.7165

>NTDB_id=179882 A1D33_RS16780 WP_015417814.1 3530087..3530464(+) (comGG) [Bacillus velezensis strain CC09]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMTQGQKVQTGTQRFPYGTVS
FHITGSDRRETVQVTIQAETTTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=179882 A1D33_RS16780 WP_015417814.1 3530087..3530464(+) (comGG) [Bacillus velezensis strain CC09]
ATGTACAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCCGGGGAATACTGGATCGGAGAGAACTTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTATGGCACCGTTTCT
TTTCACATCACGGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCGGAAACCACGACAGGAACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

50.806

99.2

0.504

Multiple sequence alignment